KEGG   Takifugu rubripes (torafugu): 101076040Help
Entry
101076040         CDS       T02386                                 

Definition
histone-lysine N-methyltransferase SETD2-like
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101076040
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101076040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1950 aa AA seqDB search
MSFFCQVKVEGLSKAALIKSLSPRVILSNHLLPKGTKMKVNLEDQGRQKVSFSFAQTKKP
LQSLFSIPTSPDKSAGSSKRSENHERSSSYSKSDRDSKHTYSRSSRSDKDRRRTRSRSRS
RSRSRGSRTSSSHSRPDRSRGDCGSRSDRSYYHDSDRRSHRGSPRRDRRRSRSRTDRNRD
SSDSEDDHRKARTRASDSSRPSAYSGLYKDSKSFSYSKSEKGCKSSDSPHLSEFDKRTQS
SKSDRTSKRPSDSDSQRKGFPDLDSSYRKSSSHHKSESHKSSSSSTRSRSQMHERHQKSS
SSDSDAEQRGKTHISDRRSGSEESSQKRSSTADSKQGKPTVKKVISVKEIELPHQQGSDS
SQKDIETHSTQGRLTEIWTHDVISKSTEMHRERSEPSQGGNSGQRVSSNAYADNRAANIQ
ICTGDGDREGASSKLSRADGSAGLSEATDSDNSDYDSDCGEVIKRLHSVVVVPKNSSLTI
DTHDTVATQCTPFSRSGVQNPSILAHVNTSEVPQQRLGNPPAAFVGTSVTRTHVNDSSFN
SLLCQSQSNMIDSTSHSEASASIRTQPYTAGDISVQGTVPGPTHGDFIRQCEQECKQGDT
SSRGEKMYSHYQPVHFSNADNINGKIGFSLGWGFSQPEQPSSTYQQPDSSHGPHLASTKM
TGAFLQHQEHMQSTALWNHQSLNMQSSGQNFHHMHQHYQETTSVVHPDSLTNDHDDYSGE
KRSKTDNDSTGSISHPLDPSSFVQGHEISSNSRGSIVSDPPRDDHLRPHRGRGPPKKRRP
EVESDSDNEAEAGPADKRERLGDIGTSKETQAKTDAHRPSLSLQDFHDANKWKEHSKSKK
MPPYFDLIEENLYLTERKKSKSHRDIKRMQCECPVLPREERSKGALACGEDCLNRLLMIE
CSSRCQNGAYCSNRRFQMRQHADFDVILTEDKGWGLRAAKDLPSNTFVLEYCGEVLDHKE
FKTRVKEYARNKNIHYYFMALKNNEIIDATLKGNLSRFMNHSCEPNCETQKWTVNGQLRV
GFFTTKAVTAGTELTFDYQFQRYGKEAQKCFCGTLSCRGFLGGENRVSVRAAGGKMKKDR
SRKSALTTVDEELEALLENGEGLYDEKQVVSLCRLMVRVETMEQKLMCLKLIQDTQNSSC
LKQFLDHHGLSLLWIFMVELSEAKGNSSNNTKLQLEILKTLAVLPISTKNMLAESKVLTF
IQRWAQTKSILQPAEMDGYSSENTSRAQTPLNTPDGTSSKVGQELDSDNTKPVSRRLKII
SENSLDSAISDASKVSDGKEEEDDEEEEEEESSNVTKQDADKAASGSEEQPGETSTDATL
ISETPEACVPSEVSQATPAETSVIGTPSQDEEEGVSDVESERSQEPQLNALDVSTMASRL
LESWKDLKEVYRIPKKSQVEKEANGKERDRDRDYDRDRDWDRDWDRDRDRDRDRSSDKTP
RSTERRRRRSTSPPSSYERSSRRTEERFDPSNSNKTPRGAVGGKERNKLSTEERRKLFEQ
EVAQREAQKQQQLQQQQQQQLQTMAYNAPLAYTSSPGFVTYPPGYPMQTFVDPSNPNAGK
VLLPTPSVEPTLTYEQTPSQQNISDIGLNSPSSTSQATPVSNLSHHITTTNLTTGSHQQY
VQPTVATQDAGVAVLPVPAQTAPQVQGQQSYTTLWDPTTQQTVTVQAQPAQQYTAAPAQA
QPQTAIYYQGQPCQTIYSIPTAYPQPNTPVIQAYSEPTASYLHSQPVYSGHQQGVVVQQG
GTVTTIVTSQTVQQVEMIVPNNVIDLPPPSPPKPKTIVLPPNWKVARDPEGKIYYYHIVT
RQTQWDPPTWEGGGENTNVDHESEMDLGTPTYDENPNKFSTKTAEADTSSELAKKSKETF
RKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKACTNPEDLECNE
NVKHKAKEYIKKYMQRFGSVYRPKEDTEVF
NT seq 5853 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcttttgtcaggtgaaggtggagggcctgtccaaggcagctttaatcaagagc
ctgtctcccagagtcatactgtccaatcatctcctgcccaaaggtacgaagatgaaagtc
aacctggaggatcagggccgtcagaaagtgtccttcagctttgcacagaccaagaagcca
ttgcagagcctgttcagcatcccgaccagccctgacaagtccgcaggttcctcgaagcgc
tcggagaatcacgaaaggtcgtctagttattccaaatcggaccgtgactctaaacacact
tattcacgctcgtctcgatcggacaaagatcgcagaaggaccaggtcgaggtcgcgctcg
cgctcgagatcgaggggatctcgaaccagttcatctcactcgagaccggacagatcgaga
ggcgactgtgggtcccgctccgatagatcctactaccacgactctgaccgcagatcacac
agaggttctcctcgcagagacagaagacgctcccgctctcggaccgacagaaaccgtgac
agttccgactctgaggatgatcacaggaaggcgaggacgagggcgagtgattccagcagg
ccttcagcctattcaggcctatataaagactctaaatcattttcctactcaaagtctgag
aaaggctgcaaatcttcagattctcctcacttgtcagagtttgataaaagaacccaatcc
tcaaagtctgacaggacttcaaaacgaccgtcagattcagattcccagcgcaagggcttc
cctgatctggactccagttaccgtaaatctagctcccatcacaagtcagaaagccacaaa
tcatcctcttcgagcacgcgctctcgctctcagatgcatgaaagacaccaaaaaagcagc
tccagcgattctgacgcagagcagagagggaagacgcatatctcggacagaaggtcgggc
tcagaggagagctcccagaagagaagcagcacggcagattcgaaacagggcaaacctact
gtcaaaaaagtaatctctgtcaaagaaatcgagctacctcatcagcaaggttctgattcc
agtcagaaggatatcgaaacacattccacacagggtaggctgactgaaatctggacgcac
gacgtcatctcgaaaagcaccgagatgcacagagagcgaagtgagccgtcccaggggggc
aacagcggccagcgtgtatcctcaaacgcctacgcagacaacagagctgcaaacatccag
atttgcactggtgacggcgatcgcgaaggagctagtagcaaactgagcagggccgatgga
tcggcggggctgagtgaggccaccgatagcgacaactcggactatgactccgattgtggc
gaggtcattaaacgtttgcactctgtggtggtggtgccaaaaaattcttccttgacaata
gatacgcacgacacggtggcaacacaatgcactccattcagcagatcaggagtgcagaac
cccagtatcctggctcatgtgaataccagtgaagtcccacaacaaaggctgggaaatcct
cccgctgcgttcgtagggaccagtgttacacggactcacgtgaacgattcatcttttaac
agcttgttgtgccaatcccagagcaatatgatagatagcaccagccactctgaggcctct
gcctctattcgcactcagccttacacggctggtgacatcagtgtccagggtaccgtccct
ggccccacccacggagactttatcagacagtgtgagcaggagtgcaaacagggtgataca
agcagcaggggtgaaaaaatgtactcccattatcaacctgttcatttttcaaatgctgac
aatatcaacggcaagattggatttagcctcggttgggggttttcacaaccagaacagccc
agtagtacataccagcaaccagacagcagtcacgggccgcacttggccagcacgaaaatg
acaggagcctttctccagcaccaggaacacatgcaaagcactgccttgtggaaccaccaa
tccctgaatatgcagagcagcgggcaaaacttccaccacatgcatcaacattatcaggag
actacaagtgtcgtccatcccgactccttaaccaatgaccacgatgactacagcggtgaa
aaacgcagtaaaacagacaacgacagcactggttctatctcgcatcctttggatccttcc
agttttgtccaaggtcatgaaataagcagcaatagcaggggctccatcgtatctgacccc
cccagagatgaccacttaagacctcacaggggccgggggcccccgaagaaaaggcgtcca
gaggtggagtcagattcggacaacgaagcagaagctgggcctgcagacaagagggagcgt
ctcggagacatcggcacctctaaggagacccaggcgaagaccgacgcacaccgtccgtct
ctctccctgcaagactttcacgatgccaacaaatggaaggagcattctaaatccaaaaag
atgcccccctactttgacctaatcgaggagaatctctacctgactgagagaaagaagagt
aaatcccaccgagatatcaagagaatgcagtgcgagtgtccagtgctgcccagggaggag
cgttcaaagggagcgttggcctgtggggaagactgtttgaaccgtctcttgatgattgaa
tgttcctcgcggtgtcagaatggagcgtattgttctaataggcgctttcagatgaggcaa
cacgcagactttgatgttatcctcacagaggacaaaggatggggactccgagcagctaaa
gatctgccctcaaacacatttgtgcttgaatactgtggggaagtattggaccacaaagaa
tttaaaacaagggtgaaagaatatgctcgcaataagaacatacactactatttcatggct
ctaaagaataatgagatcatcgatgcaacactcaagggtaatttatctcggtttatgaat
cacagctgtgagcccaactgtgagacacagaagtggactgtcaatggtcagctgagagtc
ggctttttcaccaccaaggctgtcactgcaggaacagagctgacatttgattaccagttc
cagagatatggcaaggaagcacagaaatgcttctgtggaacactgagctgcagaggattt
ctgggtggagaaaacagagttagtgtccgggcagctggagggaaaatgaagaaagaccgt
agtcgaaaaagtgctctcaccacggttgatgaggagctggaagcattactggaaaatgga
gaagggctgtacgatgaaaaacaggtggtgtctctctgcagactcatggtccgagtggaa
accatggagcagaaactcatgtgcctcaaactcatccaagatactcagaattcatcgtgt
ctgaagcagttcttagaccatcatgggttgtctttgctctggatcttcatggtggagctg
tctgaagctaaaggcaacagttccaataacaccaaactgcagttagagattctgaaaacc
ttggccgtgctgcccatctctactaagaacatgctggcagagagcaaagttctgaccttc
atccagaggtgggcccagacaaaatctatacttcagcctgctgagatggatgggtattcc
agtgagaatacatcccgtgctcagacgcccctcaacactcctgatggaacttcctcaaaa
gtggggcaggaattagatagcgacaacaccaagcctgtttcccgccgccttaaaattatc
agtgaaaacagccttgacagcgcaatctccgatgctagcaaagtgtctgatgggaaagaa
gaagaggatgatgaggaggaggaagaagaggaatcctctaatgtaacaaaacaagatgct
gacaaagctgcttctggcagtgaagaacaacctggtgaaacctccacagatgctacacta
atttcagagaccccagaggcctgtgtgccttctgaggtttcacaggcaacccctgcggag
acatcggtgataggcacaccttctcaagatgaggaggaaggcgtctccgatgtggagagt
gaacggagtcaggagccccaacttaatgctttggatgttagtacgatggcgtcccggctg
ctagagagctggaaggatctgaaggaggtctacagaataccaaagaagagtcaagtggaa
aaagaagcaaatggtaaggagcgtgatagagaccgagattatgaccgagatcgtgattgg
gacagagactgggaccgggaccgggaccgggaccgggacagatcctctgacaaaactcca
cgtagcaccgagagacggagaaggcgttccacttccccaccttcgtcctacgaaaggagc
agtcggcgaactgaggaacggtttgacccatctaacagcaacaaaacccctagaggtgct
gtgggtgggaaggagcggaacaagctgtccacagaggagcgcaggaagctgtttgagcag
gaggttgctcagcgcgaagctcaaaaacagcagcagcttcaacagcagcagcagcagcag
ctacagacgatggcatacaatgcccctctggcctacacctccagccctgggttcgttaca
tatcctcctggatatcccatgcagacctttgtggatccctccaaccccaacgcaggaaag
gtactgctgcctaccccttcagtcgagcccaccctcacttacgaacagacaccttcccag
cagaatatctcagacattggactcaactctccatcctccacttctcaggcaactccagtt
tctaatctctctcatcacatcaccaccactaacctcacaactggcagccaccagcagtac
gtgcagccgactgtagcaacccaggacgccggtgtagcggtcctgcctgtaccagctcag
acggcccctcaggttcagggccagcagagctacaccactctctgggaccccactactcaa
cagacggtgacagtgcaagcccagccggcacagcagtacactgcagccccagcacaggct
cagcctcagactgccatttattaccagggacagccatgccagaccatctacagcattccc
actgcttaccctcagcccaacactcccgttatacaggcatacagtgagccaactgctagt
tacctgcattcccagcctgtgtattctggtcatcagcaaggagtagtggtccagcaggga
ggcacagtcaccaccattgttacatcacaaactgtccaacaggtagaaatgattgtgccc
aacaatgtgatagacctgccccctccctctcctccaaaacccaaaactattgtcctacct
cctaactggaaagttgcccgagaccccgaaggaaagatctactattaccatattgtcacg
aggcaaacacagtgggaccctccgacctgggaaggcggcggggagaacactaatgtggac
cacgaatcagagatggacctgggaacacccacctatgatgagaaccctaacaagttttcc
accaagacggctgaggcggacacttccagtgaactggctaaaaagagcaaagagacgttc
cgtaaagagatgtcccagtttatagtgcaatgtctaaatccttatcgaaagccggactgc
aaattgggccgcatcagtaacacagaagactttaaacacttggccagaaagctaacgcac
ggagttatgaataaagagttgaaagcttgcaccaaccccgaggacctcgagtgtaatgag
aatgtgaagcacaaggccaaggagtacatcaagaagtacatgcagaggtttggttccgtg
tacaggcccaaggaggacaccgaggtgttctag

DBGET integrated database retrieval system