KEGG   Takifugu rubripes (torafugu): 101076074Help
Entry
101076074         CDS       T02386                                 

Gene name
prkaa2
Definition
(RefSeq) protein kinase, AMP-activated, alpha 2 catalytic subunit
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101076074 (prkaa2)
   04150 mTOR signaling pathway
    101076074 (prkaa2)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    101076074 (prkaa2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101076074 (prkaa2)
   04920 Adipocytokine signaling pathway
    101076074 (prkaa2)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101076074 (prkaa2)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   101076074 (prkaa2)
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101076074 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    101076074 (prkaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 557 aa AA seqDB search
MAERQQQKHEGRVKIGHYILGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVV
GKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDTEARR
LFQQIISAVDYCHRHMVVHRDLKPENVLLDANKNAKIADFGLSNMMSDGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLT
RSVASLLMFMLQVDPLKRATIKEIREHEWFKVDLPGYLFPEDPSYDATVVDEEAVREVCD
KFECMESEVVSSLYSGDPQDQLAVAYHLILDNRRIMTQASEFYLASSPPQGSFIEEGMLL
PPGVKPHPERMPPLLADSPKARCPLDALNTTRPKPLTVKKAKWHLGIRSQSRPYDIMAEV
YRAMRQLNFDWKVVNPYHLRVRKKNPVTGNLVKMSLQLYQVDSRSYLLDFKSIDDDIIEA
VGFKSGSSTPQRSGSTAGLYRPRLSIDSASPAIDQPQLSSSLPGSLSGSSPLLTPRQGSH
TMDFFEMCASLITTLAR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcggcaacaacagaagcacgaaggcagggtaaagatcggccattacatcctc
ggagacacgctcggagtggggacattcgggaaagtgaagatcggcgagcatcagctgaca
ggccataaagtggctgtaaagatcctaaacaggcagaagatccgcagcctcgatgtcgtg
gggaagatcaaacgggagatccagaaccttaaactgttccgacacccacacatcatcaag
ctgtaccaggtgataagcacccccacagacttcttcatggttatggagtacgtgtctgga
ggagagctgtttgactacatctgcaaacacggccgggtggaggacacggaagctcgccgt
cttttccagcagattatctcggctgtggactactgccacagacacatggtggtccacaga
gacctgaagcccgagaacgtccttctggacgccaacaagaatgccaagatagccgacttt
ggtctgtcaaacatgatgtcagacggggagttcttacgcacgagctgcggctcgcccaac
tacgccgctcctgaggtcatctcgggaaggctgtatgccggtccagaggtggacatctgg
agctgcggggtgatcctgtatgccctgctgtgcggtactctgcccttcgacgacgagcac
gtgcccacgctctttaaaaagatccgcgggggcgtcttctacatccccgagtacctgacg
cgttctgtggcgtcgctgctcatgttcatgctgcaggtggacccgctgaagagagccacc
atcaaagagatcagggagcacgagtggtttaaagtggaccttccaggctacctgttccca
gaggacccttcgtacgatgccacagtggtggacgaggaggccgtcagggaggtgtgtgac
aagttcgaatgtatggaatctgaggtggtgtccagcctctacagcggggatcctcaggat
cagctcgctgttgcctaccaccttatactggacaaccggcgcatcatgacccaggccagc
gagttctacttggcttctagtcctcctcagggctccttcatagaggaaggcatgctgctt
cccccgggggtcaaaccccacccggagagaatgccccccctcctggccgacagccctaag
gcccgctgtcctctcgacgctctcaacaccactcggcccaaacccctgaccgtgaagaag
gccaagtggcacctggggatcaggagccagagcagaccctacgacatcatggcggaggtg
tacagagccatgaggcagctcaacttcgactggaaggtggtgaacccgtaccacctgcga
gtgcgtaagaagaaccccgtgacaggaaacctggtgaaaatgagcctgcagctgtaccag
gtggacagcaggtcctacctcctggacttcaagagcatcgacgatgacatcattgaggcg
gtgggattcaaatcgggctcctccacccctcagaggtcagggtccaccgccggcctctac
agacccagactgagcatcgactcggccagcccggccatcgatcagccccagctcagctcc
tctctcccggggtctctgtccggaagctcccctctgctcaccccccgtcagggatcacac
accatggatttctttgagatgtgcgccagtctgatcaccacgctggcacgctga

DBGET integrated database retrieval system