KEGG   Takifugu rubripes (torafugu): 101076074Help
Entry
101076074         CDS       T02386                                 

Gene name
prkaa2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04068  FoxO signaling pathway
tru04140  Autophagy - animal
tru04150  mTOR signaling pathway
tru04371  Apelin signaling pathway
tru04530  Tight junction
tru04910  Insulin signaling pathway
tru04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101076074 (prkaa2)
   04068 FoxO signaling pathway
    101076074 (prkaa2)
   04150 mTOR signaling pathway
    101076074 (prkaa2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101076074 (prkaa2)
  Cellular community - eukaryotes
   04530 Tight junction
    101076074 (prkaa2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101076074 (prkaa2)
   04920 Adipocytokine signaling pathway
    101076074 (prkaa2)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101076074 (prkaa2)
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   101076074 (prkaa2)
Membrane trafficking [BR:tru04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101076074 (prkaa2)
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101076074 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    101076074 (prkaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 101076074
NCBI-ProteinID: XP_003973909
UniProt: H2UY55
Position
20
AA seq 557 aa AA seqDB search
MAERQQQKHEGRVKIGHYILGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVV
GKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDTEARR
LFQQIISAVDYCHRHMVVHRDLKPENVLLDANKNAKIADFGLSNMMSDGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLT
RSVASLLMFMLQVDPLKRATIKEIREHEWFKVDLPGYLFPEDPSYDATVVDEEAVREVCD
KFECMESEVVSSLYSGDPQDQLAVAYHLILDNRRIMTQASEFYLASSPPQGSFIEEGMLL
PPGVKPHPERMPPLLADSPKARCPLDALNTTRPKPLTVKKAKWHLGIRSQSRPYDIMAEV
YRAMRQLNFDWKVVNPYHLRVRKKNPVTGNLVKMSLQLYQVDSRSYLLDFKSIDDDIIEA
VGFKSGSSTPQRSGSTAGLYRPRLSIDSASPAIDQPQLSSSLPGSLSGSSPLLTPRQGSH
TMDFFEMCASLITTLAR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcggcaacaacagaagcacgaaggcagggtaaagatcggccattacatcctc
ggagacacgctcggagtggggacattcgggaaagtgaagatcggcgagcatcagctgaca
ggccataaagtggctgtaaagatcctaaacaggcagaagatccgcagcctcgatgtcgtg
gggaagatcaaacgggagatccagaaccttaaactgttccgacacccacacatcatcaag
ctgtaccaggtgataagcacccccacagacttcttcatggttatggagtacgtgtctgga
ggagagctgtttgactacatctgcaaacacggccgggtggaggacacggaagctcgccgt
cttttccagcagattatctcggctgtggactactgccacagacacatggtggtccacaga
gacctgaagcccgagaacgtccttctggacgccaacaagaatgccaagatagccgacttt
ggtctgtcaaacatgatgtcagacggggagttcttacgcacgagctgcggctcgcccaac
tacgccgctcctgaggtcatctcgggaaggctgtatgccggtccagaggtggacatctgg
agctgcggggtgatcctgtatgccctgctgtgcggtactctgcccttcgacgacgagcac
gtgcccacgctctttaaaaagatccgcgggggcgtcttctacatccccgagtacctgacg
cgttctgtggcgtcgctgctcatgttcatgctgcaggtggacccgctgaagagagccacc
atcaaagagatcagggagcacgagtggtttaaagtggaccttccaggctacctgttccca
gaggacccttcgtacgatgccacagtggtggacgaggaggccgtcagggaggtgtgtgac
aagttcgaatgtatggaatctgaggtggtgtccagcctctacagcggggatcctcaggat
cagctcgctgttgcctaccaccttatactggacaaccggcgcatcatgacccaggccagc
gagttctacttggcttctagtcctcctcagggctccttcatagaggaaggcatgctgctt
cccccgggggtcaaaccccacccggagagaatgccccccctcctggccgacagccctaag
gcccgctgtcctctcgacgctctcaacaccactcggcccaaacccctgaccgtgaagaag
gccaagtggcacctggggatcaggagccagagcagaccctacgacatcatggcggaggtg
tacagagccatgaggcagctcaacttcgactggaaggtggtgaacccgtaccacctgcga
gtgcgtaagaagaaccccgtgacaggaaacctggtgaaaatgagcctgcagctgtaccag
gtggacagcaggtcctacctcctggacttcaagagcatcgacgatgacatcattgaggcg
gtgggattcaaatcgggctcctccacccctcagaggtcagggtccaccgccggcctctac
agacccagactgagcatcgactcggccagcccggccatcgatcagccccagctcagctcc
tctctcccggggtctctgtccggaagctcccctctgctcaccccccgtcagggatcacac
accatggatttctttgagatgtgcgccagtctgatcaccacgctggcacgctga

DBGET integrated database retrieval system