KEGG   Takifugu rubripes (torafugu): 101076078Help
Entry
101076078         CDS       T02386                                 

Definition
ras-specific guanine nucleotide-releasing factor 2-like
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101076078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 1270 aa AA seqDB search
MQKSVRYNEGHALFLSVVARKEGTRRGFLSKKTAENSRWHDKFFALYQNVLFYFENEQSA
RPSGIYLLEGCTCERVPAPKMSTTGKEALEKQHYFLVVFGHDGQKPLELRSEGEGDCDEW
VDAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIVA
LNKTKERMRPYHIIHENEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLYILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARLANWPTADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYE
SNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMH
DEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGSLSL
KKEGERQCFLFTKHFLVCTRSSGGKLHLLKQGGVLSLIDCTLIEEPDNNDEEAKAGGQVF
GQLDFKLVVEPVDSPPFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENSKVT
VPHMIKSDVRLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLH
TYRIFTMAAVVMDKLADIYKKPFSSIPIRSLELFFATNQNNRGTSDVNDKSPRLCRKFSS
PPPLSIPSHASSPVQTRKLSLHSPITPRVGGLDLTSPLSNFGLNHNFSQSATSSPTSAHT
PQTPTSTATSPPPPPPPPPPPPPPSTSPPPNCSKSPQEQASPILSSPDLSPCLASEAEDL
PKIDPFCGKLRRSIRRAVLESASLEKMLPEAAQNSEAGDASPCRSPSTPRHLRYRQPGVQ
SGENSRCPVSPASAFAIATAAAGHSSPPVFPNSERTCDKDFIIRRAATNRVLNVLRHWVS
KHSQDFEMNQELKLSVIGLLEEVLRDPDLLPQERKATANILSTLSQDEQDDAQLRIEDIL
QMADCPKAECFESLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKVDKMERTPYIMKTS
QHFNDMSNLVASQIMTHTDVGSRASSIEKWVAVADICRCLNNYNGVLEITSALNRSAIYR
LKKTWAKVSKQAKALMDKLQKTVSSEGRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEG
TPNFTEEGLVNFSKMRMISHIIREIRQFQQTPYRIEHQAKVTQYLLDKTLIMDEDTLYDL
SLKIEPRLPA
NT seq 3813 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtccgttacaacgaagggcacgcgctgttcctgtcggtggtcgcgcgt
aaagagggcaccaggcgcggcttcctgagcaagaagacggcggagaacagccgatggcac
gacaagttcttcgcgctttaccagaatgtgctgttctactttgagaacgagcagagcgcg
cgcccatccgggatttacctgttggaaggatgcacctgtgagcgcgtgccagcgcctaag
atgtccaccaccgggaaggaagcgctggagaaacagcactacttccttgtcgtgtttgga
cacgacggacagaagcctctagagctgcgatccgagggggagggtgactgcgacgagtgg
gtggatgccatccagcaggccagctactcggacatcatcattgaacgcgaggtgctgatg
cagaaatacatccacctggtgcagattgtagagactgagaaggtggctgccaatcagctg
cgaacccagttagaggatcaggacacagaaatcgagaggctcaaggcagagattgtagct
ttgaataaaactaaggaacggatgcggccgtaccacatcatccatgaaaatgaagatcca
gatataaaaaagatcaagaaggtgcagagcttcatgcgggggtggctctgtcgccggaag
tggaagatcatcgttcaggactacatctgctcccctcacgctgagagcatgaggaagagg
aaccagattgtcttcaacatggtggaggctgagacagagtacgtccaccagctctacatc
ctggtcaactgtttcctcaggcctctgaggatggccgccagctccaagaaacctcccatc
agccacgacgacgtcagcagcatcttcctcaacagtgaaaccatcatgttcctacatgag
atcttccaccaagggctgaaggcgaggctcgccaactggccaactgctgacctgtttgac
atcctgctgcccatgctgaacatctatcaggagttcgtgcgtaaccatcagtacagcctg
caggttctggccaactgtaagcagaaccgagacttcgacaagttgctgaagcagtatgag
tctaacgcagcctgtgagggacggatgctggagaccttcctcacataccccatgttccag
attcctcgctacattatcaccttacatgagttgttggcacacacgcctcacgagcacgtg
gagcgcaagagtctcgagttcgccaaatccaagttagaggaactgtccagagtgatgcac
gacgaagtgagcgacacggagaacatccggaagaatctggccatcgagaggatgatagtg
gagggctgtgacatcctgctggacaccagccagaccttcgtcaggcaggggtctttaatc
cagctgccgtcggtggagcggggaaagctcagcaaggtgcgactgggctccctctcctta
aagaaggaaggcgaacgacagtgcttcctcttcaccaaacattttctggtgtgcacacgc
agctccggaggaaagcttcacctcctcaagcaaggcggcgttttgtcactgatcgactgc
acgctgatagaagagcctgataacaatgacgaggaggctaaagccggcggtcaggtcttc
ggtcagctggacttcaagctcgtcgtggaaccggtggactcgcctccgtttaccgtggtg
ctgctggctccgtcgcggcaggagaaggcggcgtggaccagcgacatcagccagtgcatc
gataatatccgctgtaatggcctgatgaccagcgtgtttgaggagaactctaaagtcacc
gtgcctcatatgatcaaatccgatgtgcgtctccataaagatgatgttgacatttgcttc
agcaagacgctcaactcctgcaaggtcccgcagatccgctacgccagtgtggagcggctg
ctggagaggctgaccgacctgcgcttcctctccatcgacttcctcaacaccttcctccac
acttaccggatcttcactatggctgcggtggtgatggacaaactggccgacatctacaag
aagcccttctcctccataccgatcaggtcattggagctgttctttgccaccaatcaaaac
aacagaggaaccagcgacgtgaacgacaagtctccccgtctgtgccggaagttctcctct
ccgcctcctctgtccatcccgtctcacgcatcctccccggtgcaaacgcggaaactctcc
cttcactcccccatcacgcccagagttgggggcctggatctgaccagcccgctgtcgaac
tttggcctcaaccacaacttttcccagtcggccaccagtagccccacgtcggcccacact
ccccaaactccgacatcgaccgccacgtctcctcctcctcctccacctcctcctcctcct
cctcctcccccttccacctccccccctcccaactgctccaagtcaccgcaggaacaagct
tctcccattctttcatcgccggacttgagcccctgcctggcttcagaggcagaagatctg
cccaagattgacccgttctgtggaaaactaagacggagcatccgcagagccgtgctggag
tcggcgtcactggagaaaatgctccccgaggcggctcagaacagcgaggcgggagacgcc
tccccctgtcgctccccgtccacgccgagacacctccgctacaggcagcctggagttcaa
tcaggagagaactcgcgctgccccgtctctcctgcttcggccttcgctatcgccactgca
gcagcaggacatagttccccaccagtttttccaaattctgaaagaacgtgtgacaaggat
ttcatcattcggcgagcggcaacgaacagagttctcaatgtgctgcggcattgggtctcc
aaacactcgcaggattttgagatgaaccaagagctgaagctgtcagtgatcggcctgctg
gaggaggtgctgagagatccagaccttctgcctcaggagagaaaagctaccgccaacatt
ctgagcactctttctcaagatgagcaagacgacgcccagttgagaatagaggacatctta
cagatggcagactgtccgaaggcagagtgtttcgagtctctctcagcgatggaactggcc
gagcagatcactctgctggatcacatcgtcttcagaagcatcccttacgaagagttcctg
ggtcagggttggatgaaggtcgataagatggaacggacgccatatataatgaaaaccagt
cagcacttcaatgatatgagcaacctggtggcctcacagatcatgacccacaccgacgtg
ggctccagggccagctccatagagaagtgggtcgctgtggcggacatctgccgctgcctc
aacaattacaacggagtactggagatcacgtccgccctcaaccgtagcgccatctaccgt
ctgaagaagacctgggctaaagtcagcaaacaggccaaagccctgatggacaagctccag
aagacggtgtcctctgaaggacggtttaaaaatctgagggagaccctgaagaactgcaac
cccccctgcgttccatatctgggaatgtacctgacagatttggcctttattgaggaggga
acgccaaatttcacagaggagggacttgtaaacttctccaaaatgaggatgatatcgcac
atcatcagagagatccgacagttccagcagactccgtacagaatagagcatcaggccaag
gtgacccagtaccttctggataaaactctgatcatggatgaagacaccctctacgacctc
tcgctgaagatcgagcccaggcttcctgcctga

DBGET integrated database retrieval system