KEGG   Takifugu rubripes (torafugu): 101076141Help
Entry
101076141         CDS       T02386                                 

Definition
neuropathy target esterase-like
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101076141
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101076141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1320 aa AA seqDB search
MGQSTSEQEVQEHIPKDGFNNFKTFVEEELQTSMMVGMVIGAGIAIVLIAILIFFILRRI
QLRTLEAKEAPKYRFRKRDKVMFYGRKIMRKVSQSTLSLVGTSSSTRPSSKKRQMMHNIA
KNILHYKVVPTLVAKGPPPSVLEADLTEFDVATSHLPSEVLYMLKNVRVLGHFEKPLFLE
LCKHMVFKQFQQGEHVFRPGQPDSSIYVVKDGKIELCLTGSDGKESVVKEVFPGDSVHSL
LSILDVITGHQKPYKTVSARAAEFSSVLCLPVEAFLSIFGKYPESLVRVVQIIMVRLQRV
TVLALHNYLGLTNELFSHEMHPSRLSPASPYMTRTSPIRHGKRFGSLSVPEEHREAALKN
GEQGKDGAVPTLSRAISMPVDISCMQKNPRSDLGSERGRSFLGTGEGNANFAFSQSVSQE
QREKRVTVDEVPSGIYLYPEEESETDKILTPPSTRYSSDLFEEGKKDILKLMGIEDPSLL
NGRLTLHNAKAGAVLARQGDQDVSLHFVLSGCLHVYQRMINKQEAICLFVTLPGEMVGQL
AVLTGEPLIFTIKAVRDCTYLKMSKSDFYEIMREQPSVVLRTAHTVAIRMSAFVRQMDFA
IDWMAVEAGRALYRQDDKSDCTYIVLNGRLRSVIRKANGKKELVAEYGRGDLIGVVEALT
KQPRATTVHAVRDTELVKLPEGTLTNIKRQYPQVVTRLIHLLGQKILGNLQQARGPFSGK
GAGMTTNTDVINPASNLSTVAVLPVCDEVPINAFNLELSHALSAIGPTLLLTSDNIRERL
GASALDIIHEYRLSGWLAQQEDLNRIVLYQTDNRMTPWTQRCIRQADCILIVGLGDQEPT
LGELEQMLENTAVRALKKLILLHKEDGPGPSRTVEWLNMRSWCSGHLHLKCPRRVFSRRS
PIKLRDLYEKVFEKTPDRHSDFSRLARVLTGNSIALVLGGGGARGCSHVGVIKAMEEAGI
PIDIVGGTSIGSFIGALYADERSPVRTKQRAREWSKAMNSVFKTVLDLTYPITSMFSGSA
FNSSIYKVFQDKQAEDLWLPYFNVTTDITASAMRVHQDGSLWRYVRASMTLSGYLPPLCD
PKDGNLLMDGGYINNLPADIARNMGARTVIAIDVGSQDETDLCNYGDCLSGWWLLWKRLN
PWAEKVKVPDMAEIQSRLAYVSCVRQLEVVKQSAYCEYIRPPIDRFNTMDFGKFDEIYDV
GYQHGKVVFTGWARGDIIENMLKDRRSADYNDSKFTDSCACSGADFTDLAEIVSRIEPVQ
GYVTEEESDCLTEYEEDGMDTVREEDGAEDNDSGEHPSAQTRKSVRHRRKPASESNTSDT
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgggacagagtacttcggagcaagaggtccaagaacacatcccaaaggatgggtttaat
aactttaagacatttgtggaggaggagctgcagacaagcatgatggtcgggatggtgatc
ggtgccggcattgctatagtgctgatagccatcctcatcttcttcatcttgcggaggatt
cagctccggaccctagaagctaaggaggcgccaaaataccgctttcgcaaaagggacaag
gtcatgttctacggcaggaagatcatgcggaaagtctcccagtccaccttgtccctggtg
ggcacgtcctcgtccactcggccaagctcgaagaagaggcagatgatgcataacattgcc
aaaaatattttgcactataaggtggtgccaacgctggtggccaaaggaccccctccctca
gtgctagaagctgaccttacagagtttgatgtggccacctcccatctcccatctgaggtg
ctgtacatgctcaaaaatgttcgggtcctgggtcactttgagaagcctctctttttggag
ctgtgtaagcacatggtgtttaagcagttccagcaaggggagcacgtctttaggccaggg
cagcctgacagcagcatctacgtggtgaaggatgggaagatagaattgtgccttactgga
tcagatggcaaagagagcgtggtgaaggaggttttcccaggggatagtgtccacagcctc
ctcagcatcctggatgtcatcacaggccaccaaaagccttacaaaacggtgtcagcgcgg
gctgcggagttttcatctgtcctctgtttacctgtcgaagcctttctctccatatttggg
aagtaccccgagagtctcgtgagggtggtgcagataatcatggttcgtctccaaagagtc
acagtcctcgccctgcacaactatcttggcctcactaatgagctcttcagccatgaaatg
cacccctcccgcctgtcgcctgcatctccttacatgactcgcactagtcccattcgtcat
ggcaaacgcttcggcagcctgtctgttcccgaggagcaccgtgaagctgcccttaaaaat
ggagaacaagggaaggatggagcagtgccaactcttagcagagccatctccatgcctgta
gacatttcctgtatgcagaaaaacccgagatcagatttggggtctgagagaggaagatca
tttcttggaacaggggagggaaatgccaattttgcttttagtcagtctgtgtcacaagag
cagcgggagaagagggttactgtagatgaagtcccttcggggatctatctgtacccagag
gaggagtcagaaacggacaaaatcctcacgcctccatctactcggtattcctcagatctg
tttgaagaaggaaagaaagacatcctcaaactcatgggaattgaggacccatccttgtta
aatggcagattgactctacacaatgcaaaagctggagccgtcttagcccgacagggggac
caggatgtcagtttgcactttgtcctgtctggttgtctgcacgtctaccaacgaatgatt
aacaagcaggaggccatttgtttgtttgtgaccctccctggagagatggtgggccagctg
gctgtgctcactggagaacctctcatcttcacaatcaaggctgttcgagactgtacttac
ctcaagatgtcaaagtcagatttttacgagatcatgagggagcagcccagtgttgtgctg
agaacagctcacaccgtggccatccgtatgtccgctttcgtccgacagatggactttgcg
atcgactggatggctgtggaggccggcagagccctctacaggcaggatgacaagtccgac
tgcacctacatcgttttgaacggacgtctgcggtcagttatacgcaaggcgaatggaaag
aaagaactagtggctgaatatggcagaggtgacctgattggcgtggtggaagctttaacc
aagcagccaagagccaccactgtccacgctgtgagagacacggagctggtgaagctgccc
gagggaaccctcacaaacatcaaaagacagtacccccaggtggtgacacggttgatccac
ctgttgggtcaaaagattctaggcaacctgcagcaggctcgtggtcccttctcgggtaaa
ggagcaggcatgacgaccaacactgatgtcatcaaccctgccagcaacctctctaccgtg
gctgttctgcccgtgtgtgacgaggtgccaatcaatgcgttcaacctggagctcagccac
gccctcagtgcaatagggcccactctacttttaaccagtgacaacatcagagagcgactg
ggtgcttctgcgttggacattatccacgagtaccgtctctccggctggctggcccagcag
gaggacctaaataggatcgtcctttaccaaaccgacaacagaatgacaccgtggacccag
cgctgcatccgccaggctgactgcatcctcattgtgggacttggggatcaggagcccacc
ctcggagaattggaacagatgctggagaacactgctgtccgggctctaaaaaagttgatc
cttcttcataaagaggatggaccaggtccatccaggacagtcgagtggctgaacatgcgc
agctggtgctcagggcatcttcacctcaaatgtccccgtagagttttttccagacgcagc
cccatcaaattacgggatctatacgagaaggtgtttgagaaaacaccagataggcacagc
gacttctctcggctggcccgagtcctgacaggaaacagcatcgctcttgtgctgggagga
ggcggcgccagaggatgctctcacgtgggtgtgatcaaggctatggaggaagcagggatt
cctattgacatagtgggtgggacgtctatcggttcattcattggtgcgctgtatgctgac
gagaggagtcccgtcagaaccaaacagagggccagggagtggtccaaggcaatgaattca
gtttttaaaactgtgctggatctgacgtatcccatcacctccatgttttccggttctgcc
ttcaactcaagcatctataaggtgtttcaggacaagcaagctgaggacctgtggttgccc
tactttaatgtgacaactgacattacagcttcagccatgcgtgttcaccaggatggctct
ctgtggcgctatgtgcgagctagcatgaccctttcggggtatctgccacctctctgcgat
cccaaagatggcaacttgctaatggacggtggctacatcaacaacctaccagccgatata
gcaagaaacatgggcgccaggaccgtcatcgccatcgatgtgggcagccaagatgagacc
gacctctgtaactatggcgactgcctgtctggctggtggttgttgtggaaacgactcaat
ccgtgggccgagaaagtaaaggtccccgacatggcagagatccagtcccggctggcgtac
gtctcgtgcgtgcggcagctggaggtggtgaagcagagcgcctactgcgagtacatcagg
ccgcccatagaccgcttcaacacgatggactttggcaagtttgatgagatttacgacgtg
ggctatcagcacggtaaggtggtatttaccggctgggcccggggcgacatcatcgagaac
atgctgaaagaccgccgctctgcagactacaacgacagcaagttcaccgactcctgcgcg
tgttcgggcgccgacttcaccgacctggcagagatcgtgtccaggatcgagccggtccaa
ggctacgtaaccgaagaagagtcagactgtctgacagagtatgaggaagatgggatggac
acggtcagagaggaggacggagcggaggacaacgactcgggggagcatccctctgctcag
acgcgcaaaagtgtcagacatcggaggaaaccggccagtgaatccaacacctcggacacc
tga

DBGET integrated database retrieval system