KEGG   Takifugu rubripes (torafugu): 101076189Help
Entry
101076189         CDS       T02386                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101076189
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101076189
   04070 Phosphatidylinositol signaling system
    101076189
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101076189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 784 aa AA seqDB search
MLGSGKTPVGHSREEKRTAEPGRRLGLENEDIRVMMQGSNMVKVRSSRWQKSRNVRLLED
GLTVWCESTKSSRRAKAKQTFAATEVECIREGCQSEALRRLSRSVHDKQCFTVVFRGARK
SLDLVCPSEAEAQCWVRGLRTLKEYVANMSQKEKLDHWIRGYLRRADQNQDGKMSYEEVK
RLLQMINIDLSEQYARCLFKRCDRSGDDRLDHIEIEEFCRELLRRPELDAVFRHYSSNGC
VLATAELRDFLGDQGEDASLKHAQSLILTYELNEWAQKNQLMTQNGFTMYMLSQENDVFN
PDHGRVHQDMSHPLAHYFISSSHNTYLTKDQVTSASSTEPYIRALNQGCRCVELDCWDGD
RGEPVIYHGHTLTSKVPFKEVIETIAQYAFKASPYPLILSLENHCSVEQQAVMAKNLRTI
LGGKLLTRPLTSEPLTDLPSPEELRGRILIKGKKHTPHLAQLGKNGSCASFSSSSDEEVA
NAVKNASKKEPAKVSLKLSPELSELVVYCRSVPFRGFENLFENPPNEMSSFSESEALRLI
KDSGKLFARHNSRQLSRIYPSGQRLQSSNYDPQEMWNGGCQMVALNFQTPGEQMDLNQGR
FLPNGRCGYVLKPSFLCSPTSNFNPENTGGGPGHIPTQLTIRIISAQQLPKINADKFSSI
VDPQVWVEIHGVAIDNTKGKTHRIDNNGFNPRWDCTLGFQLQVPELALVRFVVEDHDHTA
KNDFVGQFTLPFTSLRTGYRHVHLLKADGSSLSPATLFIHVKVTRKGIPLKTVSERLALA
KAKP
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaagcgggaagactccggtcggccactccagggaggagaagaggacggcggag
cccggcaggaggctcgggctggagaatgaagacatccgtgtgatgatgcagggctccaac
atggtgaaggttcgctcctcccggtggcagaagagccggaacgtgcggctcctggaggac
ggactcaccgtctggtgcgagtccaccaagagctcccgcagagccaaagctaagcagacg
ttcgccgccacagaggtggagtgcatccgcgaaggctgccagtctgaggcgctgaggcgc
ctctcgaggtccgtgcacgacaagcagtgcttcaccgtggtcttcagaggagccaggaag
agcctggacctggtgtgccccagcgaggctgaggcccaatgctgggtccgagggctccgc
acgctgaaggaatacgtggccaacatgagtcagaaggaaaagttggaccattggatccga
ggctacctgaggagagcggaccagaaccaggacggaaaaatgagctacgaggaggtgaag
cggttactccagatgatcaacatcgacctgagcgagcagtacgcccgctgtttgttcaag
aggtgcgaccgatccggagacgatcgtctggaccacatagagatcgaggagttctgcagg
gagctgctgcggcggcctgaactcgacgccgtattcaggcactattccagtaacggctgc
gtgctggccaccgcagagctgcgcgacttcctgggagaccaaggagaagacgcctcgctg
aagcacgcccagagcctcatcctcacgtatgagctcaacgagtgggctcagaagaaccag
ctcatgacccagaacgggttcaccatgtacatgctgtcccaggagaacgacgtgtttaac
cccgaccacggcagggtccaccaggacatgagccaccccctggcccattacttcatctct
tcgtcacacaacacttaccttaccaaggaccaagttaccagcgccagcagtactgagcct
tacatcagggcgctgaatcaggggtgccgctgcgtggagctggactgctgggatggagac
cgaggagaaccggtcatctaccacggacacactctcacctccaaagtgcccttcaaggag
gtgatcgaaaccatcgcccagtacgccttcaaggcatctccttaccctctaatcctgtct
ctggaaaatcactgctctgtggagcagcaggccgtcatggccaaaaacctgcgtaccatc
ctgggaggcaaacttctcaccaggcccctcacttctgagccgctgacggatctgccctct
cctgaggagctgaggggtcgcatcctgataaaggggaagaagcacactcctcacctggct
cagctgggaaagaacggcagctgcgccagcttctcctccagctccgacgaagaagtggca
aacgctgtcaagaacgcgtcgaaaaaggagcctgcgaaggtcagcctgaaactgagcccg
gagctgtcggagctggtggtgtactgcaggagcgttcccttccgaggcttcgaaaatctg
tttgaaaaccctcccaatgaaatgtcctccttctctgaaagcgaagccctcaggctcatc
aaggactctgggaagctttttgcgagacacaacagcagacagctgagccggatctacccc
tctggccagcgcctccaatcatccaactatgatccgcaggaaatgtggaacgggggctgc
cagatggtggctctgaacttccagacacccggcgaacagatggacctgaaccagggccgc
ttcctccccaacggtcgctgtggatacgtcttgaaacccagcttcttgtgcagccccacg
tctaacttcaaccccgagaacacaggaggagggcccggacacatcccgacccagctgacc
atacgaataatctcagcacagcagctgcccaaaatcaacgcagataagtttagctccatt
gttgacccccaagtgtgggtggaaattcacggggtggccattgataacacaaagggcaaa
acccaccgcattgacaacaacggttttaacccgcggtgggactgcaccctgggcttccag
cttcaggtccctgagctggccttggtcaggtttgtggttgaggaccatgaccacacagcc
aaaaacgacttcgtgggccaattcacacttcctttcacgagcttgcggacaggctaccga
catgttcatttgctgaaggcagatggttccagtctgtcacccgccaccctcttcatccac
gttaaagtgacccgcaaaggaatccccctcaagacggtgtctgagcgtttggccttggcc
aaagccaagccttga

DBGET integrated database retrieval system