KEGG   Takifugu rubripes (torafugu): 101076214Help
Entry
101076214         CDS       T02386                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101076214
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101076214
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101076214
  Exosomal proteins of colorectal cancer cells
   101076214
  Exosomal proteins of bladder cancer cells
   101076214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 509 aa AA seqDB search
MMKFLLLCTLVVASRAEIAEEDDVLVLKKSNFDEALKAHPNILVEFYAPWCGHCNALAPQ
YAKAAATLKEEGSEVRLAKVDATEETDLAQEFGVRGYPTIKFFKGGDKDSPKEYSAGRQA
EDIVSWLKKRTGPAVASLTGVTEAESLIADNEVAVIGFFKDGSSADAKAFEKAAEAIDEI
PFAMTSDDAVFSKFEVSTDSVVLFKKFDEGRNTFDGEVTKENLLNFVKSNQLPLVIEFTE
QTAPKIFGGEIKSHILMFLPKAASDFQDKMDQFKKAAEGFKGQILFIFIDSDIEDNQRIL
EFFGLKKEECPAIRLITLEDEMTKYKPESDAITTEGIIEFCTKFVEGKLKAHLMSQDIPE
DWDKTPVKVLVGKNFEEVVFDPSKNVFVEFYAPWCGHCKQLTPIWEKLGEKYKDSADTIV
AKMDSTANEIEAVKVHSFPTLKFFPAGDEHKVIDYNGERTLEGFTKFLESGGKEGGAPAG
DDEDDPEADDLQDIEDDTDGEDDDGHDEL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagttcctgctcctctgtacgctggttgtggccagccgggctgaaatagccgaa
gaagatgacgttctggtgctgaagaaaagtaacttcgacgaggctctcaaagctcatcct
aacattctggttgaattctatgccccatggtgtggtcactgcaacgccctggctccccag
tacgcaaaggctgctgccacgctaaaggaagagggttctgaagtgcgcctggcaaaggtg
gacgccacagaggagacggacctagcccaagagtttggagtccgaggataccccaccatc
aaatttttcaaaggaggagataaagattctccaaaagagtactctgctggcagacaggca
gaggacatcgtcagttggctgaagaagcgcacaggccccgctgtcgccagcctgacaggc
gtgactgaagccgagtctctcattgccgacaatgaggtggccgtcatcggattcttcaag
gatggtagctctgctgatgcaaaggcatttgaaaaagcagccgaagccattgatgaaatt
ccctttgccatgacctcggacgacgcagttttctcaaagttcgaggtgtccacggacagt
gttgtcctcttcaagaagtttgatgaaggtcgcaacacttttgatggcgaggtgaccaaa
gagaacctcctgaattttgtcaagtccaaccagctgcctcttgtcatcgagttcaccgag
cagactgctcctaaaatctttggtggtgaaatcaagtcccacatcctcatgttcctgcct
aaagctgcttcagatttccaagataaaatggaccagtttaagaaagctgccgaagggttt
aagggtcagatcctcttcatattcattgacagtgatattgaggacaaccagcgcatcctt
gagttctttggcctgaagaaagaggagtgtccagccatccgcctgattactctggaggat
gagatgaccaagtacaagcctgagagtgatgccatcaccaccgagggcatcattgagttc
tgcacgaagttcgtagagggcaaactcaaggcccacctcatgagccaggacatccctgaa
gactgggacaaaacccctgttaaggttttggttggcaaaaatttcgaagaagttgtcttt
gatccctcaaagaacgtctttgtggaattttatgcaccttggtgtggacattgcaaacag
ctgactcccatctgggagaagctcggtgagaagtacaaagacagcgctgacaccattgtg
gccaagatggactccacagccaatgagatcgaagcggttaaggtccacagcttccccaca
ctcaaattcttccctgcaggagatgagcataaggtgatcgactacaatggggaaagaacg
ctggaaggctttaccaagttcctggagagcggcggtaaagagggcggtgcccctgcaggg
gacgatgaggacgacccggaggcagatgatttacaggacattgaggacgacaccgatggt
gaagacgatgacggacacgacgaattgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system