KEGG   Takifugu rubripes (torafugu): 101076214Help
Entry
101076214         CDS       T02386                                 

Gene name
p4hb
Definition
(RefSeq) prolyl 4-hydroxylase, beta polypeptide
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101076214 (p4hb)
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101076214 (p4hb)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101076214 (p4hb)
  Exosomal proteins of colorectal cancer cells
   101076214 (p4hb)
  Exosomal proteins of bladder cancer cells
   101076214 (p4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 566 aa AA seqDB search
MRTSADPSLLSTCLCHVSSGRHKIPATLPNLHQGGKKDPKQSSAYLSGYPLPTFSATMMK
FLLLCTLVVASRAEIAEEDDVLVLKKSNFDEALKAHPNILVEFYAPWCGHCNALAPQYAK
AAATLKEEGSEVRLAKVDATEETDLAQEFGVRGYPTIKFFKGGDKDSPKEYSAGRQAEDI
VSWLKKRTGPAVASLTGVTEAESLIADNEVAVIGFFKDGSSADAKAFEKAAEAIDEIPFA
MTSDDAVFSKFEVSTDSVVLFKKFDEGRNTFDGEVTKENLLNFVKSNQLPLVIEFTEQTA
PKIFGGEIKSHILMFLPKAASDFQDKMDQFKKAAEGFKGQILFIFIDSDIEDNQRILEFF
GLKKEECPAIRLITLEDEMTKYKPESDAITTEGIIEFCTKFVEGKLKAHLMSQDIPEDWD
KTPVKVLVGKNFEEVVFDPSKNVFVEFYAPWCGHCKQLTPIWEKLGEKYKDSADTIVAKM
DSTANEIEAVKVHSFPTLKFFPAGDEHKVIDYNGERTLEGFTKFLESGGKEGGAPAGDDE
DDPEADDLQDIEDDTDGEDDDGHDEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacttccgctgacccctctctgctttctacgtgcttgtgccacgttagtagcggt
agacacaaaataccagctactctcccaaaccttcaccaagggggtaaaaaagacccaaaa
caaagctcagcctatctctccggttatccactgcctacattttccgcaactatgatgaag
ttcctgctcctctgtacgctggttgtggccagccgggctgaaatagccgaagaagatgac
gttctggtgctgaagaaaagtaacttcgacgaggctctcaaagctcatcctaacattctg
gttgaattctatgccccatggtgtggtcactgcaacgccctggctccccagtacgcaaag
gctgctgccacgctaaaggaagagggttctgaagtgcgcctggcaaaggtggacgccaca
gaggagacggacctagcccaagagtttggagtccgaggataccccaccatcaaatttttc
aaaggaggagataaagattctccaaaagagtactctgctggcagacaggcagaggacatc
gtcagttggctgaagaagcgcacaggccccgctgtcgccagcctgacaggcgtgactgaa
gccgagtctctcattgccgacaatgaggtggccgtcatcggattcttcaaggatggtagc
tctgctgatgcaaaggcatttgaaaaagcagccgaagccattgatgaaattccctttgcc
atgacctcggacgacgcagttttctcaaagttcgaggtgtccacggacagtgttgtcctc
ttcaagaagtttgatgaaggtcgcaacacttttgatggcgaggtgaccaaagagaacctc
ctgaattttgtcaagtccaaccagctgcctcttgtcatcgagttcaccgagcagactgct
cctaaaatctttggtggtgaaatcaagtcccacatcctcatgttcctgcctaaagctgct
tcagatttccaagataaaatggaccagtttaagaaagctgccgaagggtttaagggtcag
atcctcttcatattcattgacagtgatattgaggacaaccagcgcatccttgagttcttt
ggcctgaagaaagaggagtgtccagccatccgcctgattactctggaggatgagatgacc
aagtacaagcctgagagtgatgccatcaccaccgagggcatcattgagttctgcacgaag
ttcgtagagggcaaactcaaggcccacctcatgagccaggacatccctgaagactgggac
aaaacccctgttaaggttttggttggcaaaaatttcgaagaagttgtctttgatccctca
aagaacgtctttgtggaattttatgcaccttggtgtggacattgcaaacagctgactccc
atctgggagaagctcggtgagaagtacaaagacagcgctgacaccattgtggccaagatg
gactccacagccaatgagatcgaagcggttaaggtccacagcttccccacactcaaattc
ttccctgcaggagatgagcataaggtgatcgactacaatggggaaagaacgctggaaggc
tttaccaagttcctggagagcggcggtaaagagggcggtgcccctgcaggggacgatgag
gacgacccggaggcagatgatttacaggacattgaggacgacaccgatggtgaagacgat
gacggacacgacgaattgtag

DBGET integrated database retrieval system