KEGG   Takifugu rubripes (torafugu): 101076265Help
Entry
101076265         CDS       T02386                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04141  Protein processing in endoplasmic reticulum
tru04210  Apoptosis
tru04217  Necroptosis
tru04621  NOD-like receptor signaling pathway
tru04622  RIG-I-like receptor signaling pathway
tru04920  Adipocytokine signaling pathway
tru05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101076265
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101076265
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101076265
   04217 Necroptosis
    101076265
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    101076265
   04622 RIG-I-like receptor signaling pathway
    101076265
  Endocrine system
   04920 Adipocytokine signaling pathway
    101076265
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101076265
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101076265
Messenger RNA biogenesis [BR:tru03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101076265
Ubiquitin system [BR:tru04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101076265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_4 zf-C3HC4_3 zf-C3HC4_2 zf-RING_5 zf-RING_2 zf-RING_6 Paramyxo_NS_C zf-C3HC4_5
Motif
Other DBs
NCBI-GeneID: 101076265
NCBI-ProteinID: XP_003965428
UniProt: H2VF06
Position
6
AA seq 520 aa AA seqDB search
MARISMDCSSSLPGIPLSVLSVPMENKYKCQQCLQVLRKPVQAQCGHRFCIHCFKELTSS
GPKPCEACRQEEIYEEPISVLNSNEVFPDNAAGREIASLPARCLNQGCSWTGSIKQYEAQ
HEGRCELEQIKCDACQASVLRAEIDRHNERECEARTLNCKYCKLTFHFKDIKAHDDICLK
FPLPCKDCGKKKIPREKFNEHIRSCAKSKSACPFSEVGCKSVVDNGKLREHEHSSTVEHL
HLLLPMVLSLTRTRAEVSESGEWQEDSGLGLYRAPEEGVNVGAGAAASVHAVDLEKKVTA
LENIICVLNREVERSALKVEAFAHQHCLDQEKIENLVSKVGQLERAIAMRDLQLSETEQM
VRELQSCTYDGIFVWKISEFSRRRQEAVAVRMPTMFSPAFYSSKYGYKMCLRLYLNGDGT
GRGTHLSLFFVVMRGKCDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVTSSSFQRPIS
EMNIASGCPLFCPLAKLAGKSPYLKDDTIFIKAIVDLTGL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggctcggatttcaatggactgctcctcatctttgccggggattcccctcagtgtgttg
tcggtgcccatggagaacaaatataaatgtcagcagtgtctccaggtgctgaggaagcct
gtccaggctcagtgtggtcaccgcttctgcatccattgcttcaaggagctcaccagttct
gggccaaaaccatgtgaagcctgccgccaagaggagatatacgaagagcccatttccgtt
ctaaatagtaacgaggtatttccagacaacgccgctggacgagagatagcaagcctccct
gccaggtgcttgaaccagggctgcagttggaccggctctataaagcagtatgaggctcag
cacgaaggccgctgcgaattggagcagattaagtgcgacgcctgccaagcctccgtcctc
cgtgcggagatcgacagacataacgagagagaatgtgaagcccggacgctcaactgcaaa
tactgcaaactcaccttccattttaaagacatcaaggcccacgatgacatctgtttgaag
ttccccttaccctgcaaggactgtgggaaaaagaagatccccagagaaaagttcaacgag
cacatccggtcctgcgccaagtccaaaagtgcctgtcccttcagcgaagtgggctgcaaa
tctgtggtggacaacggaaagctcagggagcacgagcacagcagcaccgtggaacacctg
cacctgctgctgcccatggtgctgtccttgacccggacgcgggcggaggtttccgaatcc
ggggagtggcaggaggattctggtctaggcctgtaccgggctcctgaggagggagttaat
gtgggcgccggagctgcagcctccgtgcacgctgtggacttggaaaaaaaggtgacggct
ctagaaaacatcatctgcgtcctgaaccgagaggtggagcgcagcgcgttgaaagtggag
gctttcgcacaccagcattgtttagaccaggaaaagatcgagaacctggtgagcaaagtg
ggtcagctggaacgggcgatcgccatgagagacctgcagctgtctgagaccgaacagatg
gtgcgagagctccagtcctgcacctacgatgggatattcgtctggaaaatctccgaattc
tcacgtcgcaggcaggaagccgtggccgtccgcatgcctacgatgttctcgccagcattt
tactccagtaaatacggctacaaaatgtgcttgaggttgtacttgaacggagatgggacg
gggcgagggacgcacctctcactgttctttgtggtcatgaggggcaagtgtgacgcgctg
ctcaaatggccgttcagtcagaaggtgaccctgatgctcttggaccagaacaacagggaa
cacatcatcgacgcctttcgccctgatgtgacctccagctcctttcagcggcccatcagt
gagatgaacatcgccagcggctgcccgctcttctgcccgctggctaaactggccggcaag
agcccgtatctgaaggacgataccattttcatcaaagctatcgtagacctgacaggctta
tag

DBGET integrated database retrieval system