KEGG   Takifugu rubripes (torafugu): 101076265Help
Entry
101076265         CDS       T02386                                 

Definition
(RefSeq) TNF receptor-associated factor 2-like
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101076265
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101076265
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    101076265
  Endocrine system
   04920 Adipocytokine signaling pathway
    101076265
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101076265
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101076265
Messenger RNA biogenesis [BR:tru03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101076265
Ubiquitin system [BR:tru04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101076265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 520 aa AA seqDB search
MARISMDCSSSLPGIPLSVLSVPMENKYKCQQCLQVLRKPVQAQCGHRFCIHCFKELTSS
GPKPCEACRQEEIYEEPISVLNSNEVFPDNAAGREIASLPARCLNQGCSWTGSIKQYEAQ
HEGRCELEQIKCDACQASVLRAEIDRHNERECEARTLNCKYCKLTFHFKDIKAHDDICLK
FPLPCKDCGKKKIPREKFNEHIRSCAKSKSACPFSEVGCKSVVDNGKLREHEHSSTVEHL
HLLLPMVLSLTRTRAEVSESGEWQEDSGLGLYRAPEEGVNVGAGAAASVHAVDLEKKVTA
LENIICVLNREVERSALKVEAFAHQHCLDQEKIENLVSKVGQLERAIAMRDLQLSETEQM
VRELQSCTYDGIFVWKISEFSRRRQEAVAVRMPTMFSPAFYSSKYGYKMCLRLYLNGDGT
GRGTHLSLFFVVMRGKCDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVTSSSFQRPIS
EMNIASGCPLFCPLAKLAGKSPYLKDDTIFIKAIVDLTGL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggctcggatttcaatggactgctcctcatctttgccggggattcccctcagtgtgttg
tcggtgcccatggagaacaaatataaatgtcagcagtgtctccaggtgctgaggaagcct
gtccaggctcagtgtggtcaccgcttctgcatccattgcttcaaggagctcaccagttct
gggccaaaaccatgtgaagcctgccgccaagaggagatatacgaagagcccatttccgtt
ctaaatagtaacgaggtatttccagacaacgccgctggacgagagatagcaagcctccct
gccaggtgcttgaaccagggctgcagttggaccggctctataaagcagtatgaggctcag
cacgaaggccgctgcgaattggagcagattaagtgcgacgcctgccaagcctccgtcctc
cgtgcggagatcgacagacataacgagagagaatgtgaagcccggacgctcaactgcaaa
tactgcaaactcaccttccattttaaagacatcaaggcccacgatgacatctgtttgaag
ttccccttaccctgcaaggactgtgggaaaaagaagatccccagagaaaagttcaacgag
cacatccggtcctgcgccaagtccaaaagtgcctgtcccttcagcgaagtgggctgcaaa
tctgtggtggacaacggaaagctcagggagcacgagcacagcagcaccgtggaacacctg
cacctgctgctgcccatggtgctgtccttgacccggacgcgggcggaggtttccgaatcc
ggggagtggcaggaggattctggtctaggcctgtaccgggctcctgaggagggagttaat
gtgggcgccggagctgcagcctccgtgcacgctgtggacttggaaaaaaaggtgacggct
ctagaaaacatcatctgcgtcctgaaccgagaggtggagcgcagcgcgttgaaagtggag
gctttcgcacaccagcattgtttagaccaggaaaagatcgagaacctggtgagcaaagtg
ggtcagctggaacgggcgatcgccatgagagacctgcagctgtctgagaccgaacagatg
gtgcgagagctccagtcctgcacctacgatgggatattcgtctggaaaatctccgaattc
tcacgtcgcaggcaggaagccgtggccgtccgcatgcctacgatgttctcgccagcattt
tactccagtaaatacggctacaaaatgtgcttgaggttgtacttgaacggagatgggacg
gggcgagggacgcacctctcactgttctttgtggtcatgaggggcaagtgtgacgcgctg
ctcaaatggccgttcagtcagaaggtgaccctgatgctcttggaccagaacaacagggaa
cacatcatcgacgcctttcgccctgatgtgacctccagctcctttcagcggcccatcagt
gagatgaacatcgccagcggctgcccgctcttctgcccgctggctaaactggccggcaag
agcccgtatctgaaggacgataccattttcatcaaagctatcgtagacctgacaggctta
tag

DBGET integrated database retrieval system