KEGG   Takifugu rubripes (torafugu): 101076274Help
Entry
101076274         CDS       T02386                                 

Gene name
bco1
Definition
(RefSeq) beta-carotene oxygenase 1
  KO
K00515  
beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101076274 (bco1)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     101076274 (bco1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 522 aa AA seqDB search
MEAIFAKNGSETPEPVEAEVRGSIPSWLQGTLLRNGPGLFSVGNSQYNHWFDGLSLIHSF
TFRNGEVTYRSKFLRSETYKKNCTSNRIVVSEFGTMVYPDPCKNIFSRAFTHLCNAIPDF
TDNNLINIIRYGKDYYASSEINYINQIDPVTLETVGRVNYRNHIALNLATAHPHYDEEGN
TYNMGTALIGLGLPKYVIFKIPAETSDKGHKKPALRKVQQICSIPFRSTMFPSYFHSFGM
TENYIVFVEQPFKLDIIKLATAYFRGVTWGSCLKFDKDDATFFHIINRTTGKAVSTRFYG
DALVVFHHINAYEDDGHLVCDLITYSDSSLYDMFYIRNVKQDTSNFVQSNQSFCPPVCKR
FVFPLNVNKDSPRGSNLVTLTDTTAQAAMQEDGSIYCQPDTLFEGLELPGINYKFNSKKY
RFFYGSRVEVSPHPYKLAKIDVVTRKHLEWKQELCFPSEPVFVASPGADEEDDGVILSSV
ISSDPKVSPFMLILDAKTFTEIARASIPTSVHLDLHGLFIPD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaggccatatttgccaagaatggatcagaaactccagaaccagtcgaggctgaagtc
aggggttccattccgtcatggctgcagggcaccctgctgaggaacgggcccggcctcttc
tcggtgggcaattcacagtacaaccactggtttgatggcctgtcactcatccacagcttc
accttcagaaacggcgaggtgacctacaggagcaagtttctgaggagcgaaacctacaaa
aagaactgcacgtccaacaggattgttgtctccgagtttgggacgatggtttatccggat
ccctgcaaaaacatcttctccagagcatttacgcacctctgcaacgccatcccggacttc
accgacaacaacttgatcaatatcattcgctatggcaaggactactacgccagctccgag
atcaactacatcaaccagatcgaccccgttaccctggaaaccgtgggcagggtgaactac
cggaaccacatcgctctgaacttggcaacggctcaccctcactatgacgaggagggcaac
acctacaacatgggcaccgctctgatcgggctggggctgccaaagtacgtcatcttcaaa
atcccagctgagacttcagataagggccacaagaagccggcgctgaggaaggtccagcag
atctgttccattccgttccgctccactatgtttcccagctacttccacagcttcgggatg
acagaaaactacatcgtgtttgtggagcagccgttcaaactggatataatcaaactggcc
accgcctacttcagaggcgtcacttggggaagctgcctcaaatttgataaggatgacgcc
accttctttcacatcatcaacagaacgacaggaaaggccgtctccacccgtttctatggg
gacgctttggtagttttccaccacatcaacgcatacgaggatgatgggcacttggtgtgt
gacctgataacctacagcgacagcagcctatacgacatgttctacatcagaaatgtcaaa
caggacacaagcaacttcgtccagtccaaccagagcttctgcccaccagtttgcaagagg
ttcgtcttcccgctgaacgtcaacaaggattcccccagaggatctaatttggtgactctg
acagacaccacagctcaggcagcgatgcaggaggacggatccatctactgccaaccagac
accctgtttgaaggtctcgagcttcctgggatcaactacaagtttaactccaagaagtac
agattcttctacgggtccagggtggaggtttctccacatccctacaagctggccaagatt
gacgtcgtgaccaggaaacacctcgagtggaagcaagagctctgtttcccgtcagaacca
gtgtttgtggcatctcctggggctgatgaggaagatgacggggtcattttgtcatcggtc
atctcttcggatccaaaggtctcgccgttcatgctcatcctcgacgcaaaaacatttaca
gaaatcgcccgagcctccatccccaccagcgtccacttggaccttcacggacttttcatt
cctgattga

DBGET integrated database retrieval system