KEGG   Takifugu rubripes (torafugu): 101076274Help
Entry
101076274         CDS       T02386                                 

Definition
beta,beta-carotene 15,15'-monooxygenase-like
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101076274
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     101076274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 522 aa AA seqDB search
MEAIFAKNGSETPEPVEAEVRGSIPSWLQGTLLRNGPGLFSVGNSQYNHWFDGLSLIHSF
TFRNGEVTYRSKFLRSETYKKNCTSNRIVVSEFGTMVYPDPCKNIFSRAFTHLCNAIPDF
TDNNLINIIRYGKDYYASSEINYINQIDPVTLETVGRVNYRNHIALNLATAHPHYDEEGN
TYNMGTALIGLGLPKYVIFKIPAETSDKGHKKPALRKVQQICSIPFRSTMFPSYFHSFGM
TENYIVFVEQPFKLDIIKLATAYFRGVTWGSCLKFDKDDATFFHIINRTTGKAVSTRFYG
DALVVFHHINAYEDDGHLVCDLITYSDSSLYDMFYIRNVKQDTSNFVQSNQSFCPPVCKR
FVFPLNVNKDSPRGSNLVTLTDTTAQAAMQEDGSIYCQPDTLFEGLELPGINYKFNSKKY
RFFYGSRVEVSPHPYKLAKIDVVTRKHLEWKQELCFPSEPVFVASPGADEEDDGVILSSV
ISSDPKVSPFMLILDAKTFTEIARASIPTSVHLDLHGLFIPD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaggccatatttgccaagaatggatcagaaactccagaaccagtcgaggctgaagtc
aggggttccattccgtcatggctgcagggcaccctgctgaggaacgggcccggcctcttc
tcggtgggcaattcacagtacaaccactggtttgatggcctgtcactcatccacagcttc
accttcagaaacggcgaggtgacctacaggagcaagtttctgaggagcgaaacctacaaa
aagaactgcacgtccaacaggattgttgtctccgagtttgggacgatggtttatccggat
ccctgcaaaaacatcttctccagagcatttacgcacctctgcaacgccatcccggacttc
accgacaacaacttgatcaatatcattcgctatggcaaggactactacgccagctccgag
atcaactacatcaaccagatcgaccccgttaccctggaaaccgtgggcagggtgaactac
cggaaccacatcgctctgaacttggcaacggctcaccctcactatgacgaggagggcaac
acctacaacatgggcaccgctctgatcgggctggggctgccaaagtacgtcatcttcaaa
atcccagctgagacttcagataagggccacaagaagccggcgctgaggaaggtccagcag
atctgttccattccgttccgctccactatgtttcccagctacttccacagcttcgggatg
acagaaaactacatcgtgtttgtggagcagccgttcaaactggatataatcaaactggcc
accgcctacttcagaggcgtcacttggggaagctgcctcaaatttgataaggatgacgcc
accttctttcacatcatcaacagaacgacaggaaaggccgtctccacccgtttctatggg
gacgctttggtagttttccaccacatcaacgcatacgaggatgatgggcacttggtgtgt
gacctgataacctacagcgacagcagcctatacgacatgttctacatcagaaatgtcaaa
caggacacaagcaacttcgtccagtccaaccagagcttctgcccaccagtttgcaagagg
ttcgtcttcccgctgaacgtcaacaaggattcccccagaggatctaatttggtgactctg
acagacaccacagctcaggcagcgatgcaggaggacggatccatctactgccaaccagac
accctgtttgaaggtctcgagcttcctgggatcaactacaagtttaactccaagaagtac
agattcttctacgggtccagggtggaggtttctccacatccctacaagctggccaagatt
gacgtcgtgaccaggaaacacctcgagtggaagcaagagctctgtttcccgtcagaacca
gtgtttgtggcatctcctggggctgatgaggaagatgacggggtcattttgtcatcggtc
atctcttcggatccaaaggtctcgccgttcatgctcatcctcgacgcaaaaacatttaca
gaaatcgcccgagcctccatccccaccagcgtccacttggaccttcacggacttttcatt
cctgattga

DBGET integrated database retrieval system