KEGG   Takifugu rubripes (torafugu): 101076276Help
Entry
101076276         CDS       T02386                                 

Definition
nuclear pore complex protein Nup205-like
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101076276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1948 aa AA seqDB search
MAAQMAVNSGASLWGPLKELWETVDGAVMKRQAESVHLLDLQLKKNKAQFLSLFRNPPKS
AEQREMVRKASTEGIAIQGQQGSRLLPEQLLKEAFILSDLFDTGELAALELLLAGEQQQP
HFPGLTRGLVAVLLYWDGKLCVANSLRSLMQSRHGKTFTLDLSEELVALTTRFTDELMNQ
GLTKRILILVSEINVTREFERLQKERGLGNEKHRKEVSDLIKESRQALADSLFSWTCQSP
LTKDDTLSLIGHLETVTAQADGSLDSVNLALVMALLYCLDVSFIEQGTEDREDLLQVLPL
LTEKQYVSAVHSRLMDSQSWKLPGLQATCRLAWALSLRVLSQLPQGCALVEFTEADEALA
DQAILGDVFLFIKEGILGCDGFGLEEFYIRRLHSLITDFLALMPMKVKQLRNRADEDARL
VHMSLQMDSELPASMRKDLDHLMILIGEFYSKDTFGLELGLEFWCPTESLQHTSLQGSYL
GMALQRPPHKQVVLSKFVRQMGDLLPSTLYISYLRMLKGLANGPQCAHYCFSLLKTNGTT
HSDNIQGVSGSPVSWEHFFHSLILYHESLRRDIPNPDATQYRHPPLRGITHREQEGLTSF
LQLLTTIVTWSENARLALCEHPQWTPIVGMLGLLQCSVPPILKAEILHCLAAFGKSPEIA
ASLWQSLEYTQILQTVRAPGQRQAAGIEVELNEIESSCEEYPLTRAFSHLISSLVECSLP
VNLGAGLRVPGFQPYLDFLRDSVFLPFPTRAYRRLAEKWEVADAVLEVFHKLLRDYEPQP
SDFVQEMVELQGEQMPAHKPPGHSIMFHLLNDSPMLALCLSLLVEGVRQLDTYSPFPGKQ
HLEMAVLHCLRLLDLALQKEVIFMDLLRESQDSMLVSPLEQLLQGVSPQTRRADHIVNIA
SQKLMAGFVECLESEEAEEGAEKVAELTDSGPQKVARVRHETQIHILNLLITSLELKMPN
LALYLLGYEVKKPVSSTTLQDPGVLGCPRSCLHAILSLLQRGTEIRSGPVLAQQAPHLAE
LCYQVIYQLCANPDTSGPTMRYLRTSQDFLYSHLQHLPFIIPSNQIAALSQMSWLIKTAA
IELRVTSLNRQRSHTQRLISLLLDDQPHTQHTAHGESGIEDETRSVSGFLHFDTVSKVRR
KLLSVLDTIEFSQDIPELLQLDFFERTQIEQVISNCEHINEQGHTVCNVKLLHRVLVAEV
NALQGMAAIGQRPLLMEEVNTILQHVVERNRVRRSLSAKRNALRSWRNLVETLLTACPAD
LIPADERQLIIRDLLLDLHDKVLSEDAAGELMPIVAGAVFTLTAHLSQSVLSEQQQGLGV
ETSGFASITNSALHLILRKLLDFILCTGGGDQRLRSHLYGSLLYYLQIAQKPEEPETLQT
GKALWERLTAPEDGFSKLQRENISIIESYGKALMDVVCRDACDGHEISRMLALAVLDRIL
SIDRQNQWLVYICNSGYLRSLVESLRQDDAALQNLLMPQPPLLKPLYIYESKMALLTRVA
KTGQGAVELLRCGLVGQLIDFQVFDMLPDSDAHRLLRDPSGFIPSPIARYRQILLPTLRL
FQVILTSTTMNHQQGAAQVLQWLIVHADTIQSLLRCRELSLGGLKELSLLTGIISKTALP
GVLEMSGEINSSACMEFQGHIHRFQRLCLSLLGRLAGSDRDRLWKQAEMAAPEDSPDGRE
EMEVALQQVCANLMEYCQTLLLQSSNQAQFSICLFSPSASEPAGRDGGQLSSTLPTMAYS
SVPALGLVLYLLKNSTSDFFRFHQSHRQSLSKLESLDQLPPEELKELCQGLVSGPGGVEK
ISSVQRSLLAKRRLVQLINNRAKLLALSSYVIETCLFVLWRHLEYYLLHYAPSDPKDPLL
SGNRLYRSGLTDDSFSGLQTSGGRGLGLSRVNQQDLDLLKSEVAASFGEALQRKLLEVEG
LYSQARSRYTFIQALVRRIRGLLRQLKN
NT seq 5847 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagatggcggtaaattcaggagccagtttgtgggggccgttgaaggagctg
tgggagacggtggatggggctgtgatgaagagacaggcagaaagtgttcatcttctagac
ttacagctaaagaaaaacaaagcacagtttctttcactgtttaggaatccgccaaagagt
gcagagcaacgggaaatggtgcgtaaagccagcacagaaggcattgccattcaaggtcag
cagggatctcgacttcttccagagcagcttttgaaagaggccttcattctcagtgacttg
tttgatactggagagctagcagctttggaacttttgttagcaggggagcagcagcagccc
cattttccaggactaacacgggggctagtagctgtgcttctctactgggatggaaagctc
tgtgttgctaactccctgcgttcacttatgcagtcacgccatggaaaaacatttaccctg
gatctgagtgaggagctggttgctttgacgacacgttttactgatgaactgatgaaccaa
ggtctgacaaaacgcatcctaattttagtctcagagataaatgtaacacgtgagtttgaa
cgactgcagaaggaacgtggcctgggcaatgaaaaacacaggaaagaggtttctgatctc
attaaagaatcccgacaagctctggcagacagtctgttttcatggacctgccaatcgcct
ttgacaaaagatgacaccctttctcttattggacacttggaaacagtgacagctcaagct
gatggctcattggacagtgtgaatctggctcttgtaatggcactgctttattgcttggat
gtcagtttcatagagcagggaacagaggatagagaagatcttctccaagtcctacctttg
ctgacagaaaagcagtatgtgtctgcagtacacagtcgtctgatggacagtcagtcatgg
aagcttccagggctgcaggctacatgccgactggcttgggctttgtctctgagggttctt
tctcagctaccacagggatgcgccctggttgagttcactgaagcagatgaggctttggct
gaccaggccattcttggagatgttttcctgtttataaaagagggcatcttgggatgtgat
ggctttggcttggaagagttttatatccgtcgcctccattcactcatcacagacttccta
gcactgatgcccatgaaggtgaaacagcttcgtaaccgtgccgatgaggatgcccgccta
gtacacatgtcattacagatggacagtgagcttccagcatcaatgcgcaaggacttagac
caccttatgatccttataggagagttttacagtaaggacacatttgggttggagttgggt
ctggagttctggtgtcctacagagtctctccaacacacttccctgcaaggttcctacctg
ggaatggcacttcaaaggcctccacataaacaggtggtcttgtccaagtttgtgcgtcag
atgggagatcttctgccctccaccctctatatctcctacctccgtatgctaaaaggcctt
gctaatggtcctcagtgtgcccactactgctttagtctacttaaaaccaatggaacaaca
cacagtgacaacatccagggagtttcagggagcccagtgtcttgggaacatttttttcac
tccctaatactctatcatgagagcctgcggagagacattccaaatcctgatgcaacacag
taccgccacccacctctcaggggaatcactcaccgagaacaagaaggacttacttcattt
ttgcagttgcttacaactattgttacatggagtgagaatgcccgactggcactgtgtgag
catccccagtggaccccaattgttgggatgttggggctacttcagtgtagtgttcctcca
atccttaaggcagagatcctgcattgcctagcagcctttgggaaatcaccagagattgct
gcatcactgtggcagtcattagagtacacccagatccttcagacggtgcgagcgccagga
cagaggcaggcagctggaattgaggtggaacttaatgagattgagtcaagctgtgaggag
tatcccctgacacgagccttcagtcacctgatcagttcattggttgagtgcagcctacct
gttaatctaggggctggattacgtgtaccaggttttcagccctacttggattttttgcgg
gattctgtattccttccttttccaaccagagcatatcgccgccttgctgagaagtgggag
gttgctgatgctgttctggaagtgttccacaagctgctgcgggactatgagccacagcca
tctgactttgtccaggaaatggttgaactacagggcgagcagatgccagcgcacaagccc
cctggtcacagcattatgtttcacctgctcaatgattcaccaatgctggcgctctgtctt
agtttgctggtggagggtgttcgccagctagacacgtattccccattccctggtaagcag
catttggagatggccgtgctgcactgtctgcgccttctggatctggccctgcagaaggag
gtgatctttatggacctcctccgggaaagccaggattcaatgttggtgtctccattggaa
caacttcttcagggggtcagtccccaaactagaagggctgatcatattgttaatattgcc
agtcaaaaactgatggcaggttttgtggagtgtttagagagtgaagaggcagaagaagga
gcagagaaagtagctgagttgacagattccggcccacaaaaggttgctagagtccgacat
gaaacccagatccacatcctgaatctgctcattacttcccttgaactcaagatgcccaac
ttggcactgtatcttttgggctacgaagtaaagaaacctgtgtcatccaccacccttcag
gatccaggtgtattgggatgtccacgaagctgcctgcatgccattttgagtctgctacaa
agaggcactgagataagatcaggacctgtacttgcccaacaggcacctcacctggctgag
ctctgctaccaggtgatctaccagctgtgtgccaatccagatacatctggacccaccatg
cgctatttgaggaccagccaagattttctgtactctcacctgcagcatttaccctttatc
atacctagtaatcaaattgctgccctgtcccagatgtcctggctcattaaaacagctgcc
attgagctgagagtgacgtcactaaaccgccagcgttcacacacacagcgcctcattagc
cttctgttggatgatcagccacacactcaacatactgctcatggggaatcaggcatagag
gatgaaacaagatcagtcagtggttttctgcattttgatacagtttctaaagtacgcagg
aagttgctgagtgtgctggacaccattgaatttagtcaggacattcctgaactgctgcag
ctagatttctttgagcgcacacagatagaacaggtgatttccaactgcgagcacatcaac
gagcaaggacacaccgtgtgtaacgttaagttgttgcatagagtgctggttgctgaggtt
aatgcactgcaaggaatggcagccattgggcaaaggccactgttaatggaggaggtaaac
acaatccttcagcatgttgtggaacgcaatcgtgttcggagaagtttaagtgcgaaacgc
aatgcgctgcgctcctggaggaacctggtggagacgctgctgactgcctgtcctgctgat
ctcatacctgctgatgagaggcagctcatcatcagagatctgctgttagacctccacgat
aaggtgttatctgaggatgctgcaggagaactgatgcccattgttgctggggccgtcttc
actctgacagcccacctcagccagtcggttttgtctgagcagcagcagggattgggagta
gaaacgtctggatttgcctctatcacgaactccgcccttcacctgattcttcgcaagctt
ctggacttcatcctttgtactgggggtggagaccagcgtctacgttctcatttgtatggt
tctctactatattaccttcaaattgcccagaaacctgaagaaccagagacactacaaaca
gggaaggcactgtgggagcgtcttacagcccctgaagatggtttctcaaaactgcaaaga
gaaaacatttctatcattgagagctacggcaaggctctgatggatgtggtgtgtcgagac
gcttgtgacgggcatgaaataagcaggatgttggctctggcagttttggaccgcattctg
tccatagaccgtcaaaatcagtggctagtctacatctgcaacagtggctacctgcggtca
ctcgtggagagcctgagacaggatgatgctgccctgcagaacctgctcatgcctcagcct
ccactcttgaaaccactctacatctatgagagcaagatggctctgctaactcgtgtagca
aaaactggtcagggagctgtggagctgctgcgctgtggcctggttggacaactgattgac
tttcaggtgtttgacatgcttcctgacagtgatgcacacagattgttgagggacccatca
ggcttcattccaagccccattgcccgctacaggcagattctgctaccaactctgaggctc
tttcaggtcattctgacgtctactaccatgaaccaccaacagggggcagcacaggttctc
caatggctgatagtccatgcagacacgattcagtcattgctgcgctgtcgggagctgagt
ttgggaggtttaaaggagctctctttgctcactggaatcatcagtaagactgctttgcca
ggtgttcttgaaatgagtggagagatcaatagttctgcttgcatggagttccagggtcac
atacacagattccagcgcctttgtttgtcattgcttggacgattggctggaagtgacagg
gacaggctgtggaagcaggcagagatggcagcacctgaagattccccagatgggcgagaa
gaaatggaggtggctctgcaacaggtgtgtgctaacctaatggagtactgccaaacactc
ctgctgcagagctcaaaccaggcacagttcagcatctgcctcttcagcccttcggcaagc
gagccagctggcagggatggaggacagctgtcatctactctgcctacaatggcgtactcc
tcggtccccgctctcggtctggtcctgtaccttctgaaaaacagcacttcagatttcttc
cgtttccaccaaagtcacagacaaagtctgagcaagctggagagcctggatcagctgcca
cctgaggaactcaaagagttgtgccaaggtctggtgtcaggcccaggaggagtggagaaa
atctcttctgtccagaggagcctgctagccaagagacgactggttcagctgatcaacaac
agagccaagctgctggctctgtcctcctatgttattgaaacctgcttgtttgtgttgtgg
cgccatttggagtactacctgttgcactatgctccctctgatcccaaagaccctttgctg
tctggaaatcgtttatacagatctggcctcacagatgactccttcagtggattgcagacc
agtggagggcgtggccttggtctgtcccgagtaaaccagcaagacttggacctgttaaaa
agtgaggtggctgccagttttggagaagctctgcagaggaagctgctggaggtggaagga
ctgtacagtcaagcccgctctcgatacaccttcatccaggcccttgttcgcaggatcaga
ggactgctcagacagctaaaaaattga

  All links  
No link information was found.   
DBGET integrated database retrieval system