KEGG   Takifugu rubripes (torafugu): 101076276Help
Entry
101076276         CDS       T02386                                 

Gene name
nup205
Definition
(RefSeq) nucleoporin 205kDa
  KO
K14310  
nuclear pore complex protein Nup205
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101076276 (nup205)
Messenger RNA biogenesis [BR:tru03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     101076276 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1968 aa AA seqDB search
MAAQMAVNSGASLWGPLKELWETVDGAVMKRQAESVHLLDLQLKKNKAQFLSLFRNPPKS
AEQREMVRKASTEGIAIQGQQGSRLLPEQLLKEAFILSDLFDTGELAALELLLAGEQQQP
HFPGLTRGLVAVLLYWDGKLCVANSLRSLMQSRHGKTFTLDLSEELVALTTRFTDELMNQ
GLTKRILILVSEINVTREFERLQKERGLGNEKHRKEVSDLIKESRQALADSLFSWTCQSP
LTKDDTLSLIGHLETVTAQADGSLDSVNLALVMALLYCLDVSFIEQGTEDREDLLQVLPL
LTEKQYVSAVHSRLMDSQSWKLPGLQATCRLAWALSLRVLSQLPQGCALVEFTEADEALA
DQAILGDVFLFIKEGILGCDGFGLEEFYIRRLHSLITDFLALMPMKVKQLRNRADEDARL
VHMSLQMDSELPASMRKDLDHLMILIGEFYSKDTFGLELGLEFWCPTESLQHTSLQGSYL
GMALQRPPHKQVVLSKFVRQMGDLLPSTLYISYLRMLKGLANGPQCAHYCFSLLKTNGTT
HSDNIQGVSGSPVSWEHFFHSLILYHESLRRDIPNPDATQYRHPPLRGITHREQEGLTSF
LQLLTTIVTWSENARLALCEHPQWTPIVGMLGLLQCSVPPILKAEILHCLAAFGKSPEIA
ASLWQSLEYTQILQTVRAPGQRQAAGIEVELNEIESSCEEYPLTRAFSHLISSLVECSLP
VNLGAGLRVPGFQPYLDFLRDSVFLPFPTRAYRRLAEKWEVADAVLEVFHKLLRDYEPQP
SDFVQEMVELQGEQMPAHKPPGHSIMFHLLNDSPMLALCLSLLVEGVRQLDTYSPFPGKQ
HLEMAVLHCLRLLDLALQKEVIFMDLLRESQDSMLVSPLEQLLQGVSPQTRRADHIVNIA
RYLYHRLETIFVSVPQAVSQKLMAGFVECLESEEAEEGAEKVAELTDSGPQKVARVRHET
QIHILNLLITSLELKMPNLALYLLGYEVKKPVSSTTLQDPGVLGCPRSCLHAILSLLQRG
TEIRSGPVLAQQAPHLAELCYQVIYQLCANPDTSGPTMRYLRTSQDFLYSHLQHLPFIIP
SNQIAALSQMSWLIKTAAIELRVTSLNRQRSHTQRLISLLLDDQPHTQHTAHGESGIEDE
TRSVSGFLHFDTVSKVRRKLLSVLDTIEFSQDIPELLQLDFFERTQIEQVISNCEHINEQ
GHTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEVNTILQHVVERNRVRRSLSAKRNA
LRSWRNLVETLLTACPADLIPADERQLIIRDLLLDLHDKVLSEDAAGELMPIVAGAVFTL
TAHLSQSVLSEQQQGLGVETSGFASITNSALHLILRKLLDFILCTGGGDQRLRSHLYGSL
LYYLQIAQKPEEPETLQTGKALWERLTAPEDGFSKLQRENISIIESYGKALMDVVCRDAC
DGHEISRMLALAVLDRILSIDRQNQWLVYICNSGYLRSLVESLRQDDAALQNLLMPQPPL
LKPLYIYESKMALLTRVAKTGQGAVELLRCGLVGQLIDFQVFDMLPDSDAHRLLRDPSGF
IPSPIARYRQILLPTLRLFQVILTSTTMNHQQGAAQVLQWLIVHADTIQSLLRCRELSLG
GLKELSLLTGIISKTALPGVLEMSGEINSSACMEFQGHIHRFQRLCLSLLGRLAGSDRDR
LWKQAEMAAPEDSPDGREEMEVALQQVCANLMEYCQTLLLQSSNQAQFSICLFSPSASEP
AGRDGGRAELSSTLPTMAYSSVPALGLVLYLLKNSTSDFFRFHQSHRQSLSKLESLDQLP
PEELKELCQGLVSGPGGVEKISSVQRSLLAKRRLVQLINNRAKLLALSSYVIETCLFVLW
RHLEYYLLHYAPSDPKDPLLSGNRLYRSGLTDDSFSGLQTSGGRGLGLSRVNQQDLDLLK
SEVAASFGEALQRKLLEVEGLYSQARSRYTFIQALVRRIRGLLRQLKN
NT seq 5907 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagatggcggtaaattcaggagccagtttgtgggggccgttgaaggagctg
tgggagacggtggatggggctgtgatgaagagacaggcagaaagtgttcatcttctagac
ttacagctaaagaaaaacaaagcacagtttctttcactgtttaggaatccgccaaagagt
gcagagcaacgggaaatggtgcgtaaagccagcacagaaggcattgccattcaaggtcag
cagggatctcgacttcttccagagcagcttttgaaagaggccttcattctcagtgacttg
tttgatactggagagctagcagctttggaacttttgttagcaggggagcagcagcagccc
cattttccaggactaacacgggggctagtagctgtgcttctctactgggatggaaagctc
tgtgttgctaactccctgcgttcacttatgcagtcacgccatggaaaaacatttaccctg
gatctgagtgaggagctggttgctttgacgacacgttttactgatgaactgatgaaccaa
ggtctgacaaaacgcatcctaattttagtctcagagataaatgtaacacgtgagtttgaa
cgactgcagaaggaacgtggcctgggcaatgaaaaacacaggaaagaggtttctgatctc
attaaagaatcccgacaagctctggcagacagtctgttttcatggacctgccaatcgcct
ttgacaaaagatgacaccctttctcttattggacacttggaaacagtgacagctcaagct
gatggctcattggacagtgtgaatctggctcttgtaatggcactgctttattgcttggat
gtcagtttcatagagcagggaacagaggatagagaagatcttctccaagtcctacctttg
ctgacagaaaagcagtatgtgtctgcagtacacagtcgtctgatggacagtcagtcatgg
aagcttccagggctgcaggctacatgccgactggcttgggctttgtctctgagggttctt
tctcagctaccacagggatgcgccctggttgagttcactgaagcagatgaggctttggct
gaccaggccattcttggagatgttttcctgtttataaaagagggcatcttgggatgtgat
ggctttggcttggaagagttttatatccgtcgcctccattcactcatcacagacttccta
gcactgatgcccatgaaggtgaaacagcttcgtaaccgtgccgatgaggatgcccgccta
gtacacatgtcattacagatggacagtgagcttccagcatcaatgcgcaaggacttagac
caccttatgatccttataggagagttttacagtaaggacacatttgggttggagttgggt
ctggagttctggtgtcctacagagtctctccaacacacttccctgcaaggttcctacctg
ggaatggcacttcaaaggcctccacataaacaggtggtcttgtccaagtttgtgcgtcag
atgggagatcttctgccctccaccctctatatctcctacctccgtatgctaaaaggcctt
gctaatggtcctcagtgtgcccactactgctttagtctacttaaaaccaatggaacaaca
cacagtgacaacatccagggagtttcagggagcccagtgtcttgggaacatttttttcac
tccctaatactctatcatgagagcctgcggagagacattccaaatcctgatgcaacacag
taccgccacccacctctcaggggaatcactcaccgagaacaagaaggacttacttcattt
ttgcagttgcttacaactattgttacatggagtgagaatgcccgactggcactgtgtgag
catccccagtggaccccaattgttgggatgttggggctacttcagtgtagtgttcctcca
atccttaaggcagagatcctgcattgcctagcagcctttgggaaatcaccagagattgct
gcatcactgtggcagtcattagagtacacccagatccttcagacggtgcgagcgccagga
cagaggcaggcagctggaattgaggtggaacttaatgagattgagtcaagctgtgaggag
tatcccctgacacgagccttcagtcacctgatcagttcattggttgagtgcagcctacct
gttaatctaggggctggattacgtgtaccaggttttcagccctacttggattttttgcgg
gattctgtattccttccttttccaaccagagcatatcgccgccttgctgagaagtgggag
gttgctgatgctgttctggaagtgttccacaagctgctgcgggactatgagccacagcca
tctgactttgtccaggaaatggttgaactacagggcgagcagatgccagcgcacaagccc
cctggtcacagcattatgtttcacctgctcaatgattcaccaatgctggcgctctgtctt
agtttgctggtggagggtgttcgccagctagacacgtattccccattccctggtaagcag
catttggagatggccgtgctgcactgtctgcgccttctggatctggccctgcagaaggag
gtgatctttatggacctcctccgggaaagccaggattcaatgttggtgtctccattggaa
caacttcttcagggggtcagtccccaaactagaagggctgatcatattgttaatattgcc
aggtatctgtaccacagactggaaaccatttttgtctctgtccctcaggctgtaagtcaa
aaactgatggcaggttttgtggagtgtttagagagtgaagaggcagaagaaggagcagag
aaagtagctgagttgacagattccggcccacaaaaggttgctagagtccgacatgaaacc
cagatccacatcctgaatctgctcattacttcccttgaactcaagatgcccaacttggca
ctgtatcttttgggctacgaagtaaagaaacctgtgtcatccaccacccttcaggatcca
ggtgtattgggatgtccacgaagctgcctgcatgccattttgagtctgctacaaagaggc
actgagataagatcaggacctgtacttgcccaacaggcacctcacctggctgagctctgc
taccaggtgatctaccagctgtgtgccaatccagatacatctggacccaccatgcgctat
ttgaggaccagccaagattttctgtactctcacctgcagcatttaccctttatcatacct
agtaatcaaattgctgccctgtcccagatgtcctggctcattaaaacagctgccattgag
ctgagagtgacgtcactaaaccgccagcgttcacacacacagcgcctcattagccttctg
ttggatgatcagccacacactcaacatactgctcatggggaatcaggcatagaggatgaa
acaagatcagtcagtggttttctgcattttgatacagtttctaaagtacgcaggaagttg
ctgagtgtgctggacaccattgaatttagtcaggacattcctgaactgctgcagctagat
ttctttgagcgcacacagatagaacaggtgatttccaactgcgagcacatcaacgagcaa
ggacacaccgtgtgtaacgttaagttgttgcatagagtgctggttgctgaggttaatgca
ctgcaaggaatggcagccattgggcaaaggccactgttaatggaggaggtaaacacaatc
cttcagcatgttgtggaacgcaatcgtgttcggagaagtttaagtgcgaaacgcaatgcg
ctgcgctcctggaggaacctggtggagacgctgctgactgcctgtcctgctgatctcata
cctgctgatgagaggcagctcatcatcagagatctgctgttagacctccacgataaggtg
ttatctgaggatgctgcaggagaactgatgcccattgttgctggggccgtcttcactctg
acagcccacctcagccagtcggttttgtctgagcagcagcagggattgggagtagaaacg
tctggatttgcctctatcacgaactccgcccttcacctgattcttcgcaagcttctggac
ttcatcctttgtactgggggtggagaccagcgtctacgttctcatttgtatggttctcta
ctatattaccttcaaattgcccagaaacctgaagaaccagagacactacaaacagggaag
gcactgtgggagcgtcttacagcccctgaagatggtttctcaaaactgcaaagagaaaac
atttctatcattgagagctacggcaaggctctgatggatgtggtgtgtcgagacgcttgt
gacgggcatgaaataagcaggatgttggctctggcagttttggaccgcattctgtccata
gaccgtcaaaatcagtggctagtctacatctgcaacagtggctacctgcggtcactcgtg
gagagcctgagacaggatgatgctgccctgcagaacctgctcatgcctcagcctccactc
ttgaaaccactctacatctatgagagcaagatggctctgctaactcgtgtagcaaaaact
ggtcagggagctgtggagctgctgcgctgtggcctggttggacaactgattgactttcag
gtgtttgacatgcttcctgacagtgatgcacacagattgttgagggacccatcaggcttc
attccaagccccattgcccgctacaggcagattctgctaccaactctgaggctctttcag
gtcattctgacgtctactaccatgaaccaccaacagggggcagcacaggttctccaatgg
ctgatagtccatgcagacacgattcagtcattgctgcgctgtcgggagctgagtttggga
ggtttaaaggagctctctttgctcactggaatcatcagtaagactgctttgccaggtgtt
cttgaaatgagtggagagatcaatagttctgcttgcatggagttccagggtcacatacac
agattccagcgcctttgtttgtcattgcttggacgattggctggaagtgacagggacagg
ctgtggaagcaggcagagatggcagcacctgaagattccccagatgggcgagaagaaatg
gaggtggctctgcaacaggtgtgtgctaacctaatggagtactgccaaacactcctgctg
cagagctcaaaccaggcacagttcagcatctgcctcttcagcccttcggcaagcgagcca
gctggcagggatggaggacgtgcagagctgtcatctactctgcctacaatggcgtactcc
tcggtccccgctctcggtctggtcctgtaccttctgaaaaacagcacttcagatttcttc
cgtttccaccaaagtcacagacaaagtctgagcaagctggagagcctggatcagctgcca
cctgaggaactcaaagagttgtgccaaggtctggtgtcaggcccaggaggagtggagaaa
atctcttctgtccagaggagcctgctagccaagagacgactggttcagctgatcaacaac
agagccaagctgctggctctgtcctcctatgttattgaaacctgcttgtttgtgttgtgg
cgccatttggagtactacctgttgcactatgctccctctgatcccaaagaccctttgctg
tctggaaatcgtttatacagatctggcctcacagatgactccttcagtggattgcagacc
agtggagggcgtggccttggtctgtcccgagtaaaccagcaagacttggacctgttaaaa
agtgaggtggctgccagttttggagaagctctgcagaggaagctgctggaggtggaagga
ctgtacagtcaagcccgctctcgatacaccttcatccaggcccttgttcgcaggatcaga
ggactgctcagacagctaaaaaattga

DBGET integrated database retrieval system