KEGG   Takifugu rubripes (torafugu): 101076471Help
Entry
101076471         CDS       T02386                                 

Definition
cyclic AMP-responsive element-binding protein 1-like
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Adrenergic signaling in cardiomyocytes
Melanogenesis
Class
Organismal Systems; Endocrine system; Melanogenesis [PATH:tru04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:tru04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 329 aa AA seqDB search
MKMESAVEEAQQGVETAATETVSQQITPAQIAALAQVSMATAHASATGPTVTLVQLPNGQ
TVQVHGVIQAAQPSVIQSPQVQAVQISTVAESEDSQESVDSVTDSQKRREILSRRPSYRK
ILNDLSSDAPAVPRIEEEKAEEDLSAAAAPSITTVTVPTPIYQTSSGQYIAITQGGAIQL
ANNGTDGVQGLPTLTMTSAAAAHPGATILQYAQTSDGQQILVPSNQVVVQAAAGDVQAYQ
IRAAPASTIAPGVVMASSPALPTQGATEEVTRKREVRLMKNREAARECRRKKKEYVKCLE
NRVAVLENQNKTLIEELKALKDLYCHKSE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggagtcggcagtggaggaggctcagcagggggtggagactgctgcgactgag
acagtgagccagcagatcacaccagcacagatcgctgctttggcacaggtatccatggcg
acagcccatgcctcagcaacaggtcccacagtaacactggtgcagctcccaaacggacag
acggttcaggtccacggggtcattcaggctgcacagccctctgttatccagtccccacag
gtccaggccgtgcagatctccacagtagcagaaagtgaggattcacaggagtcagtcgat
agtgtgactgactctcagaagcgtagagaaatcctgtcacgacgcccctcatacaggaaa
atcctgaacgacctttcatccgacgcccccgctgtccctcgcatcgaggaggagaaagcc
gaggaggatttatcggctgcggccgccccatcaatcacgaccgtcacggtccccacaccc
atttaccaaaccagcagcggacagtacattgcaatcacgcagggaggggccatccagttg
gctaataatggtacggacggagtccagggccttcctacgctcaccatgaccagtgcagca
gcagcacatcccggggccacaatactccaatacgcacagacaagtgatggccagcagata
ctggttcccagtaaccaggtcgtggttcaagctgctgctggtgacgtccaggcttatcag
atccgagcagcccctgccagcaccattgccccgggagttgtcatggcctcatcccctgct
ctgcccacccaaggtgctactgaggaagtcacccgcaaacgggaagttcgcctgatgaag
aacagagaggcggcccgagaatgtcgcaggaagaagaaggagtacgtcaagtgtctggag
aatcgcgtcgccgtcctggagaaccaaaacaagacactaatcgaagaactgaaagccctc
aaagacctttattgtcataaatctgaatag

DBGET integrated database retrieval system