KEGG   Takifugu rubripes (torafugu): 101076600Help
Entry
101076600         CDS       T02386                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101076600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 369 aa AA seqDB search
MSLFGTNTGFGAGGTGVFGNTTTDSHNPMKDIEVTSPPDDSISCLAFSPPTIPGNFLIGG
SWANDVRCWEVQDNGQTVPKAQQMHTGPVLGACWSDDGSKVFTASCDKTAKMWDLNSNQA
MQIAQHDGPIKAIHWIKAPNYSCIMTGSWDKTLKFWDTRSPNPMMSLQMPERCYCADVEY
PMAVVATADRGLIVYQLENQPSEFRRIDSPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTTTPQDIYAVNAISFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPITACSFNHNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAE
ELKPRNKKW
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatttgggacgaacaccgggtttggcgctggtggcaccggtgtctttggaaac
acgacgacagacagccataatcccatgaaggatattgaggtgacctctcctccagatgac
agcatcagttgtttggctttcagcccccccaccattccaggcaacttcctcatcggagga
tcctgggccaatgacgtccgatgctgggaggtgcaggacaacggtcagacagtccccaaa
gcgcaacagatgcacacaggtccagtgctcggtgcatgctggagtgacgacggaagcaaa
gttttcactgcctcctgcgacaaaacggccaagatgtgggatcttaacagcaaccaagcg
atgcagattgcacagcacgacggtccaatcaaggcaattcactggataaaagccccaaac
tatagctgtatcatgactggcagttgggacaaaacactgaagttctgggacactcgctct
cctaatcccatgatgtctctccagatgccagaacgatgctactgtgcagatgttgagtac
cccatggccgtggtcgccacagctgataggggccttatcgtgtatcagctggagaaccaa
ccttctgagtttcgccgaatagattctcctctcaaacaccagcaccgctgtgttgccata
ttcaaggacaagcagaacaaacctacaggttttgcactgggaagcatcgagggtcgagtg
gccattcactatatcaaccccccaaacccagccaaagacaacttcacctttaagtgccac
agatccaatggaaccaacaccaccaccccacaggacatttatgctgtgaacgccatttct
ttccaccctgtgcacggcacactggccactgtgggctcagacggacgcttcagcttctgg
gacaaagacgcccgcacaaagttaaagacctcagagcagctggaccagccaatcacggcg
tgctccttcaaccacaacggcaacatttttgcatacgcctccagctacgactggtcaaag
ggccacgagtattacaacccccagaaaaagaactacatcttcctgaggaacgccgctgaa
gagctgaagccacgaaacaagaaatggtga

DBGET integrated database retrieval system