KEGG   Takifugu rubripes (torafugu): 101076691Help
Entry
101076691         CDS       T02386                                 

Definition
bcl-2-like protein 1-like
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Apoptosis
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:tru04630]
Cellular Processes; Cell growth and death; Apoptosis [PATH:tru04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 218 aa AA seqDB search
MSQNRELVIFYIKYKLSQRNYPFNHNGLILEPPSRTDGQFVTTQFNGTFNGASPGTPPAT
SLATSLDTVKEALRDTGNEFELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNW
GRIVGLFAFGGALCVECVEKEMSPLVGRIIEWMTVYLDNHIQPWIQSQGGWVRFAELFGQ
DAAAESRRSQERFRNGLLVGMSLAAGIAIGSFIVRKLL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaaacagagaactggtcattttctatattaagtacaaactctcccaaagaaat
taccctttcaatcacaatggactcatattagagcctccaagtaggactgatgggcagttt
gtaactactcagttcaatggaacttttaatggtgcaagccctggaacacccccagcaaca
agtctggcaacaagtctggatacagtaaaggaagccctccgggacacaggcaatgaattt
gagctgcgatacacttgtgctttcagtgacctgcacaaccagctacacatcaccccagct
actgcttaccaaagttttgagaatgttatggatgaggtatttagggatggagtcaactgg
gggcggatagtggggctttttgcatttggtggtgctctctgtgtggagtgtgttgagaag
gagatgagtcccctggtgggccggattatagagtggatgacagtctatcttgacaaccac
attcaaccatggatccagagtcaaggaggatgggtccgttttgctgaactctttgggcag
gatgcagcagcagaaagcaggagatctcaggagagattcagaaacggactcctggtgggg
atgagcctggcagcagggatcgcaatcgggtcgttcatagtgaggaaactcctgtga

DBGET integrated database retrieval system