KEGG   Takifugu rubripes (torafugu): 101076938Help
Entry
101076938         CDS       T02386                                 

Definition
calcineurin B homologous protein 1-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
tru  Takifugu rubripes (torafugu)
Brite
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101076938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 195 aa AA seqDB search
MGSRASTLLREEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKNKNAATSEPLNSRTNKLLFAFR
LYDLDRDDKISRDELLQVLRMMVGVNISDDQLGSIADRTIQEADTNGDNSISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggatccagagcctcgacgttactgcgagaagaggaaatcgaagaaattaagaaggag
actggtttctcccacagccagataactcgtctgtacagtcgcttcaccagcctcgataaa
ggtgaaaatggaactctcagtcgggaagattttcagaggatcccagagttggccataaat
ccgctgggagacagaattatcaatgctttctttcctgagggtgaggaccaggtgaacttc
aggggcttcatgcggaccttggctcacttcaggccgattgaggacaacgagaagaacaag
aatgctgccactagcgagccgctcaacagcaggacaaacaagctgctgttcgcattccgc
ctgtatgacctggacagggatgacaaaatctctcgggatgaactgctgcaggttttgcgc
atgatggttggtgtaaacatttcggatgaccagctgggaagcattgccgacaggaccata
caggaagccgacacaaacggagataattccatttccttcactgaatttgttaaggtgttg
gagaaagtggacgtggaacagaaaatgagcatccgatttcttcactga

  All links  
No link information was found.   
DBGET integrated database retrieval system