KEGG   Takifugu rubripes (torafugu): 101076938Help
Entry
101076938         CDS       T02386                                 

Gene name
chp1
Definition
(RefSeq) calcineurin like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
tru  Takifugu rubripes (torafugu)
Brite
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101076938 (chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST HTH_23
Motif
Other DBs
NCBI-GeneID: 101076938
NCBI-ProteinID: XP_003962396
UniProt: H2U1J6
Position
2
AA seq 195 aa AA seqDB search
MGSRASTLLREEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKNKNAATSEPLNSRTNKLLFAFR
LYDLDRDDKISRDELLQVLRMMVGVNISDDQLGSIADRTIQEADTNGDNSISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggatccagagcctcgacgttactgcgagaagaggaaatcgaagaaattaagaaggag
actggtttctcccacagccagataactcgtctgtacagtcgcttcaccagcctcgataaa
ggtgaaaatggaactctcagtcgggaagattttcagaggatcccagagttggccataaat
ccgctgggagacagaattatcaatgctttctttcctgagggtgaggaccaggtgaacttc
aggggcttcatgcggaccttggctcacttcaggccgattgaggacaacgagaagaacaag
aatgctgccactagcgagccgctcaacagcaggacaaacaagctgctgttcgcattccgc
ctgtatgacctggacagggatgacaaaatctctcgggatgaactgctgcaggttttgcgc
atgatggttggtgtaaacatttcggatgaccagctgggaagcattgccgacaggaccata
caggaagccgacacaaacggagataattccatttccttcactgaatttgttaaggtgttg
gagaaagtggacgtggaacagaaaatgagcatccgatttcttcactga

DBGET integrated database retrieval system