KEGG   Takifugu rubripes (torafugu): 101076943Help
Entry
101076943         CDS       T02386                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:tru03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tru04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:tru04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 210 aa AA seqDB search
MATSEPKTTETEDQQAESQVAAGSDSSIKHPLQNRWALWYFKNDKSKSWTENLRLISKFD
TVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLNKQQRHNDLD
RFWMETLLCLVGESFDEASDDVCGAVVNVRPKGDKIAIWTSNCQNREAIMTIGQLYKERL
NIPIKAMLGYQSHDDTSSKSGSTTKNMYSI
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtcggagccgaagacaactgaaactgaagaccaacaggctgaaagccaagta
gctgcaggttctgacagctccatcaagcaccccttgcaaaacagatgggccctgtggtat
ttcaaaaacgacaagagtaaaagctggacagagaacttgcgtctcatttccaagtttgac
acggtggaagacttttgggcattgtacaaccacatacagcaaccaagcaagcttggcttc
ggctgcgattactgtttatttaaggatgggattaaaccaatgtgggaggatgacaggaac
aagctggggggccgatggctgatgaccctcaacaaacaacagaggcacaatgacctcgat
cgcttctggatggagacgctcttgtgtttagtcggggagtcatttgacgaggcaagtgac
gacgtttgtggcgctgtggtcaacgttcgacctaaaggtgacaaaatagccatctggaca
agcaactgccaaaacagggaggccatcatgacgatagggcaactttataaagagcgtctg
aacatccccatcaaagccatgctcggctatcagtcacacgacgacacatccagcaagagc
ggctccaccaccaagaacatgtactccatttga

DBGET integrated database retrieval system