KEGG   Takifugu rubripes (torafugu): 101077022Help
Entry
101077022         CDS       T02386                                 

Gene name
thbs2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  
thrombospondin 2/3/4/5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101077022 (thbs2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101077022 (thbs2)
  Cellular commiunity
   04510 Focal adhesion
    101077022 (thbs2)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101077022 (thbs2)
  Exosomal proteins of colorectal cancer cells
   101077022 (thbs2)
  Exosomal proteins of bladder cancer cells
   101077022 (thbs2)
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   101077022 (thbs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1185 aa AA seqDB search
MILQRSLVLLLISFNFLQALPEDGEQEDGSSFDLFEISHITRRTLGAKQFRGQNSDAPAY
RFIRFDHLPPVSAPILRQILRQMQNNEGFVFVASIRQDRASRGTLIGFEGPDGQRQFEIV
SNGRANSLDLVYWVDGSQNMVQFEDVDLSDSQWKNITLQVHGENANLYVGCSLLDSFILD
EPFYEHLQAEGSRMYVAKGSSRESHFRGLLQNVRLLFDTTVEDVLLSRDCEVPKQDHANI
VSESTEIVDVSPSITTNVIGQKTDEVGPDMCERSCEELSTMFQELKGLRVVVGNLIDGLQ
KVTEENTLMKEALGKMKNSKEKNMCWQDGRLFEDKEDWIVDSCTKCTCQESKIVCHQITC
PPVACASPSFVDGECCPVCLPVDSDDGWSPWSEWTECTVTCGTGTQQRGRSCDATSNPCT
GPSIQTRKCSLVKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGKDC
EGNGRETQVCSAEPCPVDGGWGPWSPWATCSVTCGGGVKTRTRECNSPRPQYGGRRCIGK
AADSDSCNKKLCPIDGCLSNPCFAGVECNSSPDGSWDCGPCPAGFRGNGTNCHDMNECDM
VSDVCYKVSGRQRCVNTDPGFHCLPCPKRYKGNQPFGMGVEAAKKNKQVCEPENPCKDKT
HNCHKHAECIYISHFSDPMYKCECRTGYAGDGFICGEDSDLDGWPNQNLVCGTNATYHCK
KDNCPSLPNSGQEDFDKDGQGDACDKDDDNDGIPDETDNCGLLYNPRQFDFDKDEVGDRC
DNCPYEHNPAQIDTDHNGEGDACAVDIDGDGILNENDNCPYVYNTDQKDTDMDGVGDQCD
NCPLLHNPDQTDVDNDLVGDQCDNNQDIDEDGHQNNQDNCPYVANSNQADHDQDGKGDAC
DYDDDNDGIPDDRDNCRLTPNADQLDSDGDGRGDACKDDFDNDSIPDILDVCPENNAISV
TDFRKFQMVHLDPKGTTQIDPNWVVRHQGKELVQTANSDPGIAVGFDEFNAVDFSGTMYV
NTDRDDDYAGFVFGYQSSSRFYVVMWKQITQTYWEDKPSKAFGISGVSLKVVNSSTGTGE
HLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQIMAD
SGPIYDKTFAGGRLGLFVFSQELVFFSDLKYECRDKAELPPVFIR
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgatactacagagaagcctcgtcttgcttctcatatcatttaatttcctccaagctttg
ccagaagatggtgagcaagaagacgggtcgtctttcgacctgttcgaaatcagccacatc
acccgcaggacgctgggggccaaacagttccggggccaaaactccgatgcccctgcatac
cgcttcatccgctttgaccacctgcccccggtcagcgcccccatactgagacaaatccta
cgacagatgcagaacaacgagggcttcgtgttcgtggccagcatacggcaggaccgtgcc
tctcggggcaccttgattggcttcgagggccccgacggccagcggcagttcgagatcgtg
tccaacggaagggccaactccctggacctggtgtactgggtggacggctcccagaacatg
gttcagtttgaggacgtggatctgtctgactctcagtggaagaacatcaccctccaggtt
catggggagaacgcaaacctgtacgtgggctgcagcctgctagacagcttcatcctggac
gagccgttctatgagcacctgcaggcggagggaagccgcatgtatgtcgcaaagggctcc
agccgggagagtcacttcaggggcctcctgcagaatgtgcggctcctctttgacaccacg
gtggaagacgtcctgctgagtagagactgtgaggtccccaaacaagaccacgcgaacatc
gtgagcgagagcacggagatcgtggacgtgagtccttccatcaccacgaatgttataggt
cagaagacagatgaggtgggacctgacatgtgcgagcgctcctgcgaggaactgagcacc
atgttccaggagctcaagggccttcgcgtcgtcgtcggcaacctcattgatggattgcaa
aaagtgacggaggagaacaccctcatgaaagaagcccttggcaagatgaagaactcaaag
gagaaaaacatgtgctggcaggacggccgcctgtttgaagataaagaggactggattgtg
gacagctgcaccaagtgtacctgccaggagtctaagattgtgtgtcaccaaataacgtgt
ccgccggtggcctgcgccagtccctcatttgtcgatggcgagtgttgccccgtgtgtctc
cctgtagacagtgacgacggctggtccccctggtccgagtggacagagtgcaccgtcacc
tgcggtacaggaactcagcagagggggcgctcatgtgacgcaaccagtaacccctgtact
ggtccttcgatccagactcgcaagtgcagcctggtcaaatgcgatagccgtgttcgccag
gacggaggctggagtctgtggtcgccgtggtcctcctgctcagtgacttgtggggaaggg
cagatcaccaggattagacactgtaatgctcctgtgcctcaactggggggcaaagattgc
gagggtaatggacgggagactcaggtctgcagtgccgagccgtgtcccgttgatggtggc
tggggcccttggtctccatgggcaacctgctcagtaacatgcggaggaggtgtcaaaact
aggacgcgtgagtgcaacagcccccggcctcagtatggtggcaggaggtgtatcgggaaa
gccgctgacagtgacagctgtaacaaaaagctctgccccatcgatggctgtctgtccaac
ccatgctttgccggagtggagtgcaacagctctccagatggatcctgggactgtggtcca
tgcccagcaggtttccgtggaaatggtaccaattgtcatgacatgaatgagtgtgacatg
gtgtctgatgtttgctacaaagtcagtggaaggcagcgctgcgtcaacaccgatccaggt
ttccactgtctaccgtgtcccaagcgctacaagggcaaccagcctttcggcatgggtgtg
gaggccgccaagaaaaacaaacaggtgtgcgaacccgagaatccttgcaaggacaaaacc
cataactgccacaaacatgcagagtgcatttacatcagccacttcagcgaccccatgtac
aagtgcgagtgtcgcactggttacgctggggacggcttcatctgtggagaggactcggat
ctggacggctggcccaatcaaaaccttgtgtgcggcactaatgcaacctaccactgcaag
aaggataactgtcccagccttcccaactctggacaggaagactttgacaaagatggtcag
ggagacgcttgtgacaaggacgacgacaacgacggaattcctgacgagacggacaactgc
ggcctcctttacaacccccggcagttcgatttcgacaaggatgaggtgggcgaccgctgc
gacaactgcccctacgagcataaccctgcccaaatagacaccgaccacaacggcgagggg
gatgcctgtgcggtggacatcgatggagatgggatcctgaatgagaacgacaactgccca
tatgtttacaacaccgaccagaaagacactgacatggacggtgttggggaccagtgtgac
aactgccccttgctgcacaaccctgaccagacggacgtagataatgacctggtcggagac
cagtgcgataacaaccaggacatcgatgaagacggccatcagaacaaccaggacaactgc
ccctatgtggccaactcaaaccaggctgaccacgaccaggatggcaaaggggatgcctgt
gactatgacgacgacaatgacggaatacctgatgacagggacaactgcagactgacgccc
aatgcagaccagctggactctgacggtgatggaagaggagacgcctgcaaagatgacttt
gacaatgacagtattccagatatccttgacgtgtgcccagagaacaatgccatcagtgtt
acagacttcaggaagttccagatggttcacttagatcctaagggaaccactcaaattgat
cccaactgggtggtgagacaccagggcaaagagctggtccagactgccaactctgatccg
ggcatcgcagtagggttcgatgagttcaacgccgtagacttcagtgggacgatgtacgtc
aacacggaccgggacgacgactatgcgggctttgtattcggctaccagtcaagcagtcgg
ttttacgtagtgatgtggaagcagattacacagacgtactgggaggacaagccctcaaag
gccttcggcatttccggcgtctcgctcaaagtcgtcaactcaagcactgggactggggaa
cacctcaggaatgctttatggcacacaggcaacacccccgggcaggtgcgcactctgtgg
catgaccccaaaaacatcggatggaaggattatacagcttacaggtggcatctcatccac
agacccaagacagggtttataagggttgtggtctatgaaggtaaacagatcatggccgac
tcgggacctatttacgacaaaacgtttgctggaggaagattaggcctgtttgtgttctct
caagagctggtgttcttctccgacctcaaatatgagtgccgagacaaagcggagttgcca
ccagtgttcataagataa

DBGET integrated database retrieval system