KEGG   Takifugu rubripes (torafugu): 101077099Help
Entry
101077099         CDS       T02386                                 

Definition
glycogen [starch] synthase, muscle-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101077099
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101077099
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101077099
Glycosyltransferases [BR:tru01003]
 Polysaccharide
  Storage polysaccharide
   101077099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 709 aa AA seqDB search
MPLARSLSVTSLSGLEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTAEEWGE
NYFLVGPYVESNVRTQVELIEPPTPILRRTIDKMNSRGCKIYFGRWLIEGSPYVILIDVG
FTAWSLDTWKSELWDISGIGVPWFDREANDAVLFGFLTAWLLGEYAAQSEEPHIVAHFHE
WLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNKLSEFNVDKEAGDRQIYHR
YCIERAAAHCAHVFSTVSKITAIEAEHLLKRKPDIITPNGLNVKKFSAMHEFQNLHAQSK
NRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADLFLESLARLNYLLRVSHSDLT
VIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKMLD
KEDFTIMKRAIFATQRQCQPPICTHNMLEDASDPILNSVRRIGLFNSSSDRVKIIFHPEF
LSSTSPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEH
IADPSAYGIYILDRRFRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYISARHMALAKAFPDIYQYELNEPTSTSGFRYPRPASVPPSPALSRHSSPHHSEAED
NDEDESYDEDLEAEKDRVNIRQPFVVPFKNKSSLFVTNGDGEGDATEKN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcccgcagcctgtccgtcacgtccctctcaggcctggaggagtgggacgag
gagtttgatttagaagacgccgttctctttgaaattgcgtgggaggtcgccaacaaagtt
ggaggcatctacaccgtcatccagacgaaagctcgcctgaccgccgaggaatggggggag
aactatttcctggtgggcccctacgtggagagcaacgtgcgcactcaggtggagctgatc
gagcccccgacccctatactgaggagaaccattgacaagatgaactccagagggtgtaag
atctactttgggaggtggctgatagagggcagcccttacgttattctgatagacgttggg
ttcaccgcctggtctctggacacctggaagagcgagctgtgggacatcagtggcattggt
gtgccgtggtttgaccgtgaggccaatgacgccgtgctatttggcttcctgacagcgtgg
ctgctcggagagtatgctgcgcaaagcgaggagccgcacattgtggctcatttccatgag
tggttggcaggcctgggcctagttctgtgcagacagaggcagctgcctgttgccaccatc
ttcaccacccacgccacactgctgggacgctacctgtgtgctgggaatgtggacttctac
aacaagctttccgagttcaatgtggataaggaagccggcgatagacagatctaccaccgc
tactgcatagagcgggcggccgcccactgcgcccacgtcttcagcaccgtgtcaaagatc
actgccatagaggcagagcacctgctgaaaaggaaaccagacatcatcactcctaacggg
ctcaacgtaaagaagttctccgccatgcacgagtttcagaacctccacgctcagagcaag
aatcgaattcaggagtttgtcagaggacatttttatgggcaccttgacttcaacctggat
aaatgtctgttcctcttcatcgctgggaggtatgagttctctaacaaaggtgctgacctc
ttcttggaatctctggcccgcctcaactatctgcttcgagtcagtcacagcgacctgacg
gttattgccttcttcattatgcccgcccgaacaaacaacttcaacgtggagacgttgaag
ggccaagcagtcaggaaacagctttgggacactgctcagaccgtgaaggaacgtttcgga
aagaaactatacgagtcacttctcgttggacagctgcctgatgtgtccaagatgctggat
aaagaggacttcaccataatgaagcgtgccatctttgcaactcagagacagtgccagccc
cccatctgcacccacaacatgcttgaggacgccagtgaccccatcctaaactccgttcga
cgcatcggcctctttaacagctcctctgaccgtgtcaaaattatctttcatccggagttt
ctttcatccacttctcctctacttcccatggattatgaggactttgtgcgaggttgccac
ctgggcgtcttcccctcttactatgagccttggggctacacgccagccgagtgcaccgtc
atgggaatcccatcaatctcaacaaacctgtcaggctttggctgtttcatggaggaacac
atcgcggacccatcagcatatggtatttacatcctggaccggaggtttcgaggagtcgac
gagtcctgcaatcagctcacttccttcctgtttcagttctgtaagcagagtcggcgccag
aggatcatccagcggaaccgaaccgagcgcctgagcgacctgctggactggcgatacctc
ggcagatattacatatctgcacgtcacatggccctggctaaagcatttcctgacatctac
cagtatgagctcaatgagccaacctcaacgtccggcttccgctaccccagaccagcctcc
gtgcccccatctccagcactgtctcgccactcctccccccaccacagcgaagccgaggac
aacgacgaagacgaaagctacgacgaggacctggaggctgagaaggaccgggtgaacatc
cgccagcccttcgtcgtgcccttcaaaaacaagtcctccctctttgtcaccaatggcgat
ggcgagggtgacgccactgagaaaaactga

DBGET integrated database retrieval system