KEGG   Takifugu rubripes (torafugu): 101077179Help
Entry
101077179         CDS       T02386                                 

Gene name
plcd4
Definition
(RefSeq) phospholipase C delta 4
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101077179 (plcd4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101077179 (plcd4)
   04070 Phosphatidylinositol signaling system
    101077179 (plcd4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101077179 (plcd4)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101077179 (plcd4)
Membrane trafficking [BR:tru04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101077179 (plcd4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101077179 (plcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 736 aa AA seqDB search
MLVGSVMRKIKSRTWKKQRYFKLQEDCMTIWYKSKKAGNTHSTFSVSDVEAIREGHQSEV
LLSIAEEFPADRCFTLVFRSRRVNLDLVAESAEEAQSWIRGIRKLMENLENMGEREKLDQ
WISDWFKKADKNNDGRMNFKEVQDLLKMMNVDMSEHHAHRLFTMADKSQSGTLEDDEFVL
FYKMLTQREDVLKVFQEYSTHGQKLSQGDLEDFLREEQLEEGDIQQHAKQLIERYEPSDT
AKLLNAMTFDGFLMYLGSMEGSIFNPQRRGIFQDMSQPLCHYFIASSHNTYLMEDQLRGH
SSMEGYIRALSRGCRCVEVDCWDGANGEPIVYHGHTFTSKILFKDVVGAVANYAFKVSEY
PVILSVENHCGIEQQRVMAEHLNHILGDKLLKSTLNGKAPVGLPSPEDLRGKILLKAKKI
GPLEDSFRGITEDSQTGEVSEEDEVAEIDDDDVHRDSVRRRRSKQRLSKELSDCVVYCKS
VHFRSFKHSRIHSKFYEVASFTESKARKHLREAGAEFVYHNSRQLTRVYPSGFRTDSSNF
NPQEMWNAGCQIVALNFQTAGEGMDLNDGLFRQNGDCGFILKPSFMRLAEKRFDPETPHE
RDNYKPIVLTVQVISGQQLPKVNIKEDSIVDPLVRVEIHGVPLDQAKQETRYIENNGFNP
VWYDTLRFTIHTPELAMVRFVVEDYDKTSKNDFVGQYTLPLSCMQQGYRHIHLLSKDGTS
IPPASLFVHIRITDLE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgggctcggtaatgagaaaaattaagtctcgcacctggaagaaacagcgctac
ttcaaactacaggaggactgcatgaccatctggtacaagtccaaaaaggctggcaacacc
cactccacattttccgtgagtgatgtagaagcgatacgagagggccaccagtctgaggtc
ctgctcagcatcgctgaggagttcccagcagatcgttgtttcacactggtcttccgcagc
cgtagagtcaacctggaccttgtggctgagtcagctgaggaagcacagtcctggatcaga
ggcattaggaagctgatggagaatctggagaacatgggggagcgagagaaactggaccaa
tggatcagtgactggttcaagaaagcggacaaaaacaacgacggccggatgaacttcaaa
gaagtgcaagatttactgaagatgatgaacgtggacatgagtgagcaccatgctcatcgt
ctctttacaatggctgataaatcgcagtcaggtacccttgaggatgatgagtttgtgctc
ttctacaagatgttaactcagagggaggatgtgctgaaggttttccaggagtactcgact
catgggcagaagttatcccagggtgacctggaggacttcctgagggaggagcagcttgag
gagggtgatattcagcagcatgccaagcagctcattgagcgctatgagccatctgacaca
gccaagctgctaaatgccatgacgtttgatggcttcttgatgtatcttggctcaatggag
ggctccatttttaaccctcaacggcggggcatcttccaggacatgagccagcccctgtgc
cattactttattgcctcctcccacaacacctacctaatggaggatcagctcagagggcat
agcagtatggagggatatatcagggctttgagtcgtggctgtcggtgtgtggaggtggac
tgctgggacggtgccaacggagagcccatagtctaccatggacacactttcacctccaag
atactctttaaagatgtggtcggtgcagtggccaactatgccttcaaggtgtcagaatat
ccagtcatcctgtccgtcgagaaccactgcggtattgagcagcaaagagtcatggccgaa
cacctcaaccacattctcggtgacaaactgctaaaaagcaccctgaatggcaaggccccg
gttggactgccatcacctgaggacctcagaggaaagatactgttgaaggcgaagaaaatt
ggaccgttggaagacagtttcagaggtattacggaggactctcagaccggggaagtcagc
gaggaagatgaggtggctgaaatcgacgatgacgatgtccatcgtgacagcgtgcggcgc
aggaggtcaaagcagcgactgtccaaggagctttcagactgtgttgtgtactgcaagagc
gtccatttcaggagcttcaagcattcccgcatccactccaagttctatgaggtggcttct
tttacggagtctaaggcacgaaaacatctgagggaggctggggctgagtttgtgtaccat
aattcaaggcagctgaccagagtttatccaagcggctttcgcacagactcttcgaatttc
aatcctcaggaaatgtggaatgctggttgccaaattgttgcattgaattttcagactgct
ggagaagggatggacctgaacgatgggctgtttcgtcagaatggcgactgtggattcatt
ctaaagcccagtttcatgagattggctgagaaaagatttgacccggagacaccacacgaa
cgggacaactataaacccatcgtcctcaccgtacaggtgattagtggtcagcagctgccc
aaagtcaatatcaaagaggactctatagtggatcctttggtcagagtggagattcatggc
gttcctttggaccaggccaagcaggagacaagatacatcgaaaacaatgggttcaaccct
gtgtggtatgatacgctccgtttcacaatccacaccccagagctggccatggtgcgcttt
gtcgtggaagactatgacaagacatccaaaaacgattttgttggccagtatacgcttcct
ctcagctgcatgcagcaaggttatcgtcacattcacttactgtccaaagatggaaccagt
attccccctgcctccttatttgtacacatcaggatcacagacctggagtaa

DBGET integrated database retrieval system