KEGG   Takifugu rubripes (torafugu): 101077277Help
Entry
101077277         CDS       T02386                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tru04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 442 aa AA seqDB search
MRPLLLGVLGCSLLLSVRAFYSPDDDVVELTPSNFNKEVIQSDALWLVEFYAPWCGHCRN
LVPDWKKAAAALKGIVKVGAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSS
QAIVDGALSALRSLVKERLSGGSSGSGYNKQQQSGSGGSKKDVVELTDDNFDQMVLESGE
VWMVEFFAPWCGHCKNLEPEWTAAATAVKEQTKGKVRLGAVDATVHQVVSSRYGIRGFPT
IKIFRKGEEPEDYQGGRTRADIIERALDLFSDNAPAPELLEILNEDVVKKTCEDSQLCVI
AVLPHILDTGATGRNGYLEVMMKMADKYKKKMWGWLWAEAGAQLELEASLGIGGFGYPAM
AAINTRKMKYALLKGSFSETGIHDFLRELSVGRGSTATFGGGAMPNIQSVDAWDGKDGQL
PEEEEYDLSDVDMDEDFDKDEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgcttctactcggagtgttgggatgctccttgctcctgtctgtccgggctttt
tactcacccgacgacgatgtcgtcgagctgaccccctccaacttcaacaaggaggtgatc
cagagtgacgctctgtggctggtggagttttacgcgccctggtgtggccactgtcggaac
ctggttccagactggaagaaggcagcagcagccctcaagggaatcgtcaaggtcggtgct
gtggatgcagaccagcacaagtcactgggtggtcagtatggcgtcagaggattccccacc
attaagatctttggagccaataagaacaagccagaggaataccaaggtgggcgcagcagc
caggccatcgtggacggagctctgagtgctctgcgtagtctggtgaaggagaggctgagt
ggaggctccagcggctcgggctacaacaaacaacagcagagcggcagtggcggcagcaag
aaggatgtggttgaactgaccgacgacaacttcgaccagatggtgctggagagtggcgag
gtgtggatggtggagttcttcgccccctggtgtggacactgcaaaaacctggaacctgag
tggacagctgctgccacagctgtcaaggagcagaccaagggcaaagttcgcctcggagct
gtggatgctaccgttcatcaggttgtgtccagccgctacgggatccgagggttccccacc
atcaagatcttccgtaaaggggaggagcctgaagactaccaaggaggccgcacccgcgct
gacatcatcgagcgggctctggatctgttctctgacaacgcccctgcccccgagctgctg
gagatcctgaatgaagacgtggtgaagaagacctgtgaggacagtcagctctgtgtcatc
gctgtcctgccacacatcctggacacaggtgccacgggtcgaaacggatacctggaagtg
atgatgaagatggctgacaagtacaagaagaagatgtggggctggctgtgggcagaagcc
ggtgctcagctggagctggaggcctctttgggcatcggtgggttcggctaccccgccatg
gcagccatcaacacccgcaagatgaagtacgctttactcaaaggctccttcagcgagacg
ggcattcacgacttcctcagggagctttcagtgggcagaggctccactgctacctttgga
gggggggccatgcccaatattcagagcgttgacgcctgggacggcaaagacggacagctc
cccgaggaggaggagtacgacctcagcgacgtggacatggacgaagactttgacaaagat
gagttgtga

DBGET integrated database retrieval system