KEGG   Takifugu rubripes (torafugu): 101077277Help
Entry
101077277         CDS       T02386                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101077277
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101077277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 442 aa AA seqDB search
MRPLLLGVLGCSLLLSVRAFYSPDDDVVELTPSNFNKEVIQSDALWLVEFYAPWCGHCRN
LVPDWKKAAAALKGIVKVGAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSS
QAIVDGALSALRSLVKERLSGGSSGSGYNKQQQSGSGGSKKDVVELTDDNFDQMVLESGE
VWMVEFFAPWCGHCKNLEPEWTAAATAVKEQTKGKVRLGAVDATVHQVVSSRYGIRGFPT
IKIFRKGEEPEDYQGGRTRADIIERALDLFSDNAPAPELLEILNEDVVKKTCEDSQLCVI
AVLPHILDTGATGRNGYLEVMMKMADKYKKKMWGWLWAEAGAQLELEASLGIGGFGYPAM
AAINTRKMKYALLKGSFSETGIHDFLRELSVGRGSTATFGGGAMPNIQSVDAWDGKDGQL
PEEEEYDLSDVDMDEDFDKDEL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagaccgcttctactcggagtgttgggatgctccttgctcctgtctgtccgggctttt
tactcacccgacgacgatgtcgtcgagctgaccccctccaacttcaacaaggaggtgatc
cagagtgacgctctgtggctggtggagttttacgcgccctggtgtggccactgtcggaac
ctggttccagactggaagaaggcagcagcagccctcaagggaatcgtcaaggtcggtgct
gtggatgcagaccagcacaagtcactgggtggtcagtatggcgtcagaggattccccacc
attaagatctttggagccaataagaacaagccagaggaataccaaggtgggcgcagcagc
caggccatcgtggacggagctctgagtgctctgcgtagtctggtgaaggagaggctgagt
ggaggctccagcggctcgggctacaacaaacaacagcagagcggcagtggcggcagcaag
aaggatgtggttgaactgaccgacgacaacttcgaccagatggtgctggagagtggcgag
gtgtggatggtggagttcttcgccccctggtgtggacactgcaaaaacctggaacctgag
tggacagctgctgccacagctgtcaaggagcagaccaagggcaaagttcgcctcggagct
gtggatgctaccgttcatcaggttgtgtccagccgctacgggatccgagggttccccacc
atcaagatcttccgtaaaggggaggagcctgaagactaccaaggaggccgcacccgcgct
gacatcatcgagcgggctctggatctgttctctgacaacgcccctgcccccgagctgctg
gagatcctgaatgaagacgtggtgaagaagacctgtgaggacagtcagctctgtgtcatc
gctgtcctgccacacatcctggacacaggtgccacgggtcgaaacggatacctggaagtg
atgatgaagatggctgacaagtacaagaagaagatgtggggctggctgtgggcagaagcc
ggtgctcagctggagctggaggcctctttgggcatcggtgggttcggctaccccgccatg
gcagccatcaacacccgcaagatgaagtacgctttactcaaaggctccttcagcgagacg
ggcattcacgacttcctcagggagctttcagtgggcagaggctccactgctacctttgga
gggggggccatgcccaatattcagagcgttgacgcctgggacggcaaagacggacagctc
cccgaggaggaggagtacgacctcagcgacgtggacatggacgaagactttgacaaagat
gagttgtga

DBGET integrated database retrieval system