KEGG   Takifugu rubripes (torafugu): 101077362Help
Entry
101077362         CDS       T02386                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101077362
   04142 Lysosome
    101077362
Exosome [BR:tru04147]
 Exosomal proteins
  Proteins found in most exosomes
   101077362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21
AA seq 1682 aa AA seqDB search
MAQILPIRFQEHLQLQNMGVNPANIGFSYLTMESDKFICIREKVGDQNQVVIVDMSDPTN
PIRRPISADSAIMNPASKVIALKAAKTLQIFNIEMKSKLKAHTMTEDVMFWKWISVNTVA
LVTDSAVYHWSMEGDSQPAKVFDRHASLAGCQIINYRTDQQQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFGDFKVEGNTKPSTLFCFAVRSQAGGKLHIIEVGQPAAGN
QPFAKKAVDVFFPPEAQTDFPVAMQIGSKHGVIYLITKYGYIHLYDLESGVCIYMNRISA
ETIFVTAPHEATSGIIGVNKKGQVLSVCVEEENIVNYATNVLQNPDLALRIALRSNLAGA
EEIFARKFNTLFSQGNYSEAAKVAASAPKGILRTAETIRKFQSVPAQPGQASPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKASDPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYTPDWVFLLRNVMRVNPDQGLQFAQMLVQDE
EPLANINQIVDVFMEGNLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHVAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSLECLRAMLSANIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSIVN
FSQEPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCAEDVIKNLIIVVRGQF
STDELVEEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNTPERFLKENPFY
DSAVVGKYCEKRDPHLACVAYERGQCDLDLIKVCNENSLFKSEARYLVHRKDPELWANVL
EENNPFRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFKKFDVNTS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLGRAQLHRGLVKEAIDSYIKAVDPSAYMEV
VNAASKNNNWEDLVKFLQMARKKARESYVETELIFALAKTNRLAELEEFVSGPNNAHIQQ
VGDRCYEEGMYEAAKLLYNNVSNFARLASTLVHLGEYQAAVDSARKANSTRTWKEVCFAC
VDGEEFRLAQICGLHIVIHADELEDLISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQSHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGLFKDIIPKVANVELYYKSLSFYLDYKPLLLNDLLTILSPRLDHSRAVSFFS
KMNQLKLVKPYLRSVQNHNNKSVNEALNNLLTEEEDYQGLRASIDAYDNFDTIGLAQRLE
KHDLIEFRRIAAYLYKGNNRWRQSVELCKKDKLYKDAMLYAAESKDAELAENLLQWFLEE
GRKECFAACLFASYDLLHPDVVLELAWRHNIMDFAMPYFIQVMREYLTKVDKLEEAESQR
KTEEEVTEPQPMVFGQQLMLTASPAPVTPQTGYPSYAYPPAGYPAAPAAGYPPQPPAYGF
NM
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatactgccgatacgatttcaggaacatctgcagttgcagaacatgggcgtg
aaccccgccaacatcgggttcagctatctcaccatggagtcggacaagtttatctgcatc
agagaaaaggtgggggaccagaaccaggtggtgattgtggacatgtccgaccccaccaac
cccatcaggaggcccatctctgccgacagcgccatcatgaaccctgccagcaaagtcatc
gcactgaaagctgccaagaccctgcagatctttaacattgagatgaaaagtaaactaaag
gctcacaccatgacagaagatgtgatgttctggaagtggatatcggtgaacaccgtcgcc
ctggtgactgattcagccgtctatcactggagcatggagggagactctcagcccgctaag
gttttcgaccggcacgccagtctggcaggctgtcagatcatcaactacagaactgatcag
caacagaagtggctgcttttgatcgggatctccgcgcagcaaaaccgcgtggttggagcc
atgcagctgtattcagtcgacaggaaagtgtcccagcccatcgagggacacgctgctgcc
tttggagacttcaaagtggaggggaacaccaaaccttccaccctcttttgcttcgccgtg
cgctcgcaagctgggggaaagttgcacatcattgaagtcggtcagccagctgcggggaac
cagccctttgctaagaaagccgttgatgtgtttttccctccagaggcgcagacagacttt
cccgtagccatgcagatcggaagtaaacatggagtcatatatttgatcacaaagtatggt
tacattcacttgtacgacctggagtctggagtttgcatctacatgaatcgaattagcgcg
gagaccatttttgtcacggctccacatgaagccacctcaggaatcattggggtgaacaag
aagggtcaggtcctctcagtctgcgttgaagaggaaaacatcgtcaactacgccaccaac
gttttacagaacccagacctggcgttgaggatagctttaaggtccaatctcgctggggcg
gaggagatttttgcgaggaagttcaacacactgttctcccagggaaattattcagaggct
gcaaaggttgctgcctcggcacctaagggaattctccgcactgcagagaccattcgtaag
ttccagagcgtcccagctcagccaggtcaggcctccccattgttgcagtactttggtatt
ctgctggaccagggtcagctcaacaagtttgagtctttggagctgtgccggcctgtcctg
cagcagggccgcaagcaactgctggagaaatggctgaaggaggacaagttggagtgctca
gaagagctgggagacctggtgaaggcatcggatcccactttagctcttagcgtgtacctc
agagctaacgtccccaacaaggtcatccagtgttttgctgaaactggccagttccagaag
attgtgctttatgccaaaaaggtgggctacacccctgactgggttttcctcctgagaaac
gtgatgcgtgtaaatccagaccagggcctgcagtttgcccagatgcttgtccaggacgag
gagccgctggccaacataaaccagattgttgacgtcttcatggagggaaatctgatccag
cagtgcacgtccttcctgttggacgctctgaagaacaaccgtcccgccgaaggacactta
cagactcgcctgcttgagatgaacctcatacatgccccccaggtcgcggatgccatcctt
gggaaccagatgttcacccattatgaccgggcccatgtggcccagctgtgcgagaaggca
ggtctcctgcaaagagctcttgaacactacacagatctgtacgacatcaaacgggcagtg
gtgcacacgcatctgctcaaccctgagtggctggtgaacttttttggctcgttgtcagtt
gaagactctttggaatgtctgagagccatgttgtcagctaacatcaggcagaacctgcag
ctctgcgtccaggtagcatcgaagtatcacgagcagctggggactcagtctttagtggaa
ctctttgaatccttcaagagttatgagggtttgttttacttccttggatcgattgtgaat
ttcagtcaggagcctgatgttcactttaagtacatccaggctgcctgcaaaacaggtcag
atcaaggaagtggagagaatctgtcgagagagcaactgctacgacccagagagagtcaaa
aacttcctcaaggaggccaagcttacagatcagctccctctgatcatcgtgtgtgatcgc
tttgactttgttcacgacttggtgctctatctctaccgcaacaatctccagaaatacatt
gaaatctacgtgcaaaaggtgaatcccagtcgtttaccggtggttataggtggactgttg
gatgtcgactgtgctgaggatgtgatcaagaacctgatcattgtggtcagagggcagttt
tccactgatgagctagtagaggaagtagaaaagaggaacaggttaaagctgttgttacca
tggcttgagtctcgcatccatgaagggtgcgaggaaccggccactcacaatgcgctggcc
aagatctatattgatagcaacaatacgcccgagcgtttcctgaaagagaacccattctac
gacagcgctgttgttggaaaatactgtgagaagagagaccctcacctggcctgtgtagct
tatgagagaggacaatgtgacctggaccttataaaggtgtgcaatgaaaactccttattc
aagagtgaggctagatatctggtccatcggaaagacccagagctttgggcaaatgtgctt
gaagaaaacaacccattcagacgacaacttatcgatcaggtggtgcagacagccctgtca
gagacccaggacccagaggaggtttcagtaaccgtcaaggccttcatgactgcagacctt
cccaatgagctgattgaactgctggaaaagatcgtactcgacaactctgtctttagcgag
cacagaaacctccagaacctgctcattctgactgccatcaaggccgaccgtactcgggtg
atggagtacattaacagactagacaactacgacgctccggacattgctaatatcgccatc
agcaatgagctgtttgaagaagcgtttgccattttcaagaagtttgatgtcaacacctct
gcaatacaggtattgatagagcacatagggaacctggaccgagcctacgagtttgcagag
cgctgtaacgaacctgcggtgtggagccagttgggcagagctcagctgcaccgaggcctc
gtcaaggaggccatcgactcgtacatcaaagctgtcgacccttctgcgtacatggaggtg
gtcaatgcagccagcaagaacaataattgggaagatctggtgaaattcctccagatggct
cgaaagaaagccagagagtcctacgtggagacggagctcatcttcgccttggctaaaaca
aaccgtctggccgaactggaggagttcgtcagtggacccaacaatgctcacatccagcag
gtgggcgatagatgctacgaggaaggcatgtacgaggcagcgaagctcttgtataacaac
gtttccaactttgctcgtctcgcctcgacactcgtacatctcggggagtaccaggcggcc
gtggacagtgccaggaaagccaacagcacacggacatggaaggaggtctgctttgcgtgc
gtggatggggaggagttccgtctggcgcaaatctgcggcctccacatcgtcatccacgct
gacgagctggaagacctgatcagctactatcaggaccgcggatacttcgaggaactcatt
gcgctgctggaggcggcgctgggtttggagcgggctcacatgggcatgttcacagagctc
gccatcctctactccaagttcaaacctcagaagatgagggaacacctggagctcttctgg
tccagagtcaatattccaaaggtcctccgtgcagcagagcagtctcacctctgggcagag
ctggttttcctttacgataaatacgaggagtacgacaacgcagtcctcacgatgatgtct
catccgactgaagcttggaaagaagggctgttcaaagacattatcccaaaagtggccaat
gtggaactgtactataaatccctctccttctatctggactataaaccgctcctactcaac
gacctgctgaccatcttgtctccacggcttgatcacagccgagcggtctcgtttttctca
aagatgaaccagctgaagctggttaagccttacctgagatcagtccagaaccacaacaac
aagtctgtcaacgaggcactcaacaacctgttgacagaggaggaagactatcagggtctg
agagcgtccatcgatgcctacgacaactttgataccattggcctggcgcagagattagag
aaacacgacctgatcgagttcagacgcattgctgcttatctttataagggtaacaaccgc
tggagacagagtgttgagctctgcaagaaggacaaactctacaaggatgccatgctgtac
gctgcagagtcgaaggatgctgagctggcagaaaatctgcttcagtggttcctggaggaa
ggcaggaaagagtgctttgctgcttgcctctttgcatcctatgacctgctgcatcccgac
gtagtgctggagctggcctggaggcacaatatcatggacttcgccatgccgtacttcatc
caggtcatgagggagtacctcacaaaggtggacaaactggaggaggcagagagccagaga
aaaacggaggaggaggtgacagaacctcagccgatggtgtttggccagcagctgatgttg
accgcctcacctgctccagtgaccccccagacgggctacccgagctatgcctaccccccc
gcaggttaccctgccgcccccgctgctggctacccccctcaacccccagcatacggcttc
aacatgtaa

DBGET integrated database retrieval system