KEGG   Takifugu rubripes (torafugu): 101077419Help
Entry
101077419         CDS       T02386                                 

Definition
mitogen-activated protein kinase 6-like
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 768 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRRLTEDVVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIRNDMSKPHTPLAKLLPDVSPQALDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPVSLHPFHIEDEVDDILLMDQSHSHTWDRCHESQL
SEADWHLHSIHDPDEVQVDPRGLSDVTDEEEVQVDPRKYADGDWEKFLDEPSFDYSLHFL
PDRSWQDNDHHENKYCDLQCSHTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWK
EQQSKEKADRKAKSKCEKNGLVKAQIALKEAGKTQDPVEKDSEQEKHQTERPQSQQTQGF
DFDSFIASTIKLSLQPEPCPEVTLLNDVGFLNELNSSVSQLEAPRSGSMSKSVSQEKEEK
CLVNLAQLGGGGLGFGDSTWPVEPCPSFAFGLTVEESGCLIDEACWDIRKEDHLQKESTY
TSYLDHLFSRKEESVVETVASLEMESSEVREVDEGFLSRNAEIVLNVQLDSLALPLPLPL
PLPLPLPGFDSSDDLPLKSIQASLTPCAVKCSPQIAHKTYSSIFKHLN
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgagtccctgatgaacatccatggttttgacctgggttcccgctac
atggacttaaagccacttggttatggagggaatggcctggtcttctccgccgtcgacacg
gattgtgataagcgtgtggctgtgaagaaaataatcttgactgacccgcagagtgtgaag
catgccctgcgggaaatcaagatcatcagacgcctcgatcatgataacattgtcaaggtt
tttgagacattgggccctagtggtcgcaggctaacggaggatgtggtgtccctgacggag
gttaactcggtgtacattgtgcaagagtacatggagacagacctttgtcaattgttggag
aggggccttctttcagagggccatgccagactcttcatgtaccagctcctcaggggcctt
aagtatatccactctgctaacgtgctgcaccgagacctcaagcccgctaacttgtttgtc
aatacggaagacctggtacttaagattggggactttggcctggctcgcatcatggacccc
cactattctcacaagggccatctttcagagggcctagtcaccaagtggtatagatcgccc
cgtctgctgctctctcctaataactacaccaaagccatcgacatgtgggcagctggctgc
atctttgccgagatgctcacagggaaaaccctctttgctggtgcccacgagctggagcag
atgcagctgatcctggagtccatacctgtgctgcgggaagaagaccgccaagagctccac
agcgtcatcccggtcttcattcgtaacgatatgtccaagcctcacacaccactagccaag
ctgctgcctgatgtctctccccaggccttggatttcttggagaagatcttgacgtttaac
cccatggaccgcctgactgctgaagaggccctggcccacccctatatggctgactactcc
ttccctttagatgagccagtctctctgcaccccttccacatagaggatgaagtagatgat
atcctgcttatggaccagagccacagccacacctgggacagatgtcatgaaagtcagctc
tctgaggctgactggcacctacacagcatccacgacccagatgaagttcaggttgaccca
agaggactctctgatgtaacagatgaagaggaggttcaggtggatcctcgcaaatatgct
gatggagattgggagaagttcctggatgagccatcctttgactactcccttcatttcctt
ccagacagatcctggcaggacaatgaccaccatgagaataaatactgtgacttacagtgt
agccatacgtgtaactacaaggccgtgtcaccctcatacctagacaacctcatctggagg
gacagtgaagtcaaccactactacgaacccaagctcattattgacctctccaactggaag
gaacagcagagcaaggagaaagctgaccgcaaggccaagagtaagtgtgagaagaatggg
ttggtaaaggcacagattgcgttaaaggaagcaggaaagacccaggatcctgtggagaag
gacagcgagcaggaaaaacaccagacagaaaggcctcaaagccaacagacccagggcttt
gattttgactcctttatcgccagcaccatcaaactgagcctgcagccagaaccctgtccg
gaggtgacgctgctcaacgatgtgggcttcctgaatgagctcaactcctccgtctcccag
ctggaggctccccgctcgggctctatgtccaagtctgtgagtcaggagaaagaggagaag
tgcctggtgaacctcgcccagttgggcggaggagggctgggattcggggacagcacctgg
cccgtcgagccttgtccgagtttcgcctttgggctgacggttgaggagagcggctgtttg
atagatgaagcatgctgggacatacgcaaagaggaccacctgcagaaggagagcacttac
accagctacctggaccacctgttcagccggaaggaagagagcgttgtggagactgtggcc
agcttggagatggagtcatcggaagtgagagaggtggacgagggcttcctcagcaggaat
gcagagattgtgctgaacgtgcagctcgattccctggctctgcccctgcccctgcccctg
cccctgcccctgcccctgcccggctttgacagctccgacgatttgcctctaaagtccatc
caggcctccctgactccctgtgctgtcaaatgctcccctcaaattgcccacaaaacttac
agcagcatcttcaagcatcttaattaa

DBGET integrated database retrieval system