KEGG   Takifugu rubripes (torafugu): 101077495Help
Entry
101077495         CDS       T02386                                 

Definition
integrin beta-8-like
Orthology
K06591  
integrin beta 8
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101077495
   04514 Cell adhesion molecules (CAMs)
    101077495
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101077495
  Cellular commiunity
   04510 Focal adhesion
    101077495
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101077495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 756 aa AA seqDB search
MTTWLRSVPLCVLLYSALSLCAQDHGAGGAMCLSASITSCAECLSHGPQCAWCFKEDFLN
GADLGWRCDLPENLLNRGCEAESMERWETKVVVNTTISSTQVSPGDISITLTPGSEASVV
VAVKQLQRYPVDLYYLVDVSASMQENLNHLKTVGVALTLRMTEHSSDLWLGFGSFVDKPV
SPYIDVHPSKINNPCSDYEIRCRPAHGFHHVLSMTGNMSEFTRVIKRQHISGNMDTPEGG
LDAMLQAAVCQEAVGWRSEAKRLLLLMTDQPSHLALDSRLAGIVVPHDGLCHLENNVYTG
STRMDHPSVGQLSDKLLENHIYSVFAVEKQQYQWYEELVRLLPAAYLGKLGLFQAPNLIE
LVVEAYKRLLSEVEVSISVEDKAVDRYSVSVSPICPEGSTLKGQSCSGVQPNQTTYFKIT
FGLRSCPDDGGDEDVTVLIHPVGYNESTVVRIHSKCVCSCGVTKRCSNDGQSPCSGMQDE
DRGPNHELMDSNKGSNRNCRPDVADVDCSGRGVCECGRCVCDRSKLGAVYGKYCEIDDFS
CPYHEGLSCGGRGACVSSECVCTDGWTGESCSCPISTATCQSASGSLCSGRGRCVCGKCA
CDDPQYSGDFCETCPACQSPCQSHWKCVDCHLSHGLAPKEAGHCNSTCIPLVGYVDDTSE
CASSSRMVGTFLSVCALTVLCGLVVVAFSRLLLQKRIRTPAGAGEDGVFHCTGKDLSYIP
TTNEKTVTYRRDNPPDHSLEMHIQVPKMPLGDPWQF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgactacctggctccgcagcgtccctctgtgtgtcctgctgtactccgcgctgtctctt
tgcgcacaagaccacggtgcgggtggcgccatgtgtttgtctgctagtatcacttcttgt
gcagagtgcctcagccatggaccacagtgcgcctggtgcttcaaagaggacttcctgaat
ggggccgacttgggctggcgctgcgacctgccagaaaatctgctcaatagaggctgcgaa
gctgagtccatggagcgttgggagaccaaggtggtggtcaacaccaccatcagcagcacg
caagtgtccccaggagacatcagcatcacactaacaccaggctcggaggccagcgtcgtt
gtggcagtgaagcagctgcagcgttaccccgtggatctctactaccttgttgatgtatca
gcatcgatgcaggagaatctgaatcatttgaagacggttggtgttgctctgacgcttcgc
atgaccgagcactcctctgacctttggctgggttttggctcatttgttgacaaacctgtc
tctccttacattgacgttcatccctcaaagatcaacaacccctgcagtgactatgagatc
cgctgtcgcccggcccacggcttccatcacgtcctgagcatgacaggaaatatgagcgag
ttcacacgtgtgatcaaacgtcagcacatctctggcaacatggacacacctgagggaggt
ctggatgccatgctacaagctgccgtctgccaggaagcagtgggttggcgatcagaagcc
aagcgtctactgctcctgatgactgatcagccgtctcacctggccctggacagccggctg
gcagggatcgtcgtgccacacgacggcctgtgtcacctggaaaacaatgtctacacagga
agcactaggatggatcaccccagcgtgggtcagttgtctgataagctccttgaaaaccat
atctactctgtctttgctgtggagaagcagcagtaccagtggtatgaggagttggtccgc
ctgttacccgccgcctacctgggaaagttgggcctcttccaggccccaaatctcattgag
ctggtggtggaggcatacaagaggttgttatctgaagtggaagtttccatctctgtagaa
gataaagctgttgacaggtactcagtgtctgtatctcccatctgtcctgagggatccact
ctaaagggccagagctgctcaggggtgcagcccaaccagacgacctactttaagatcacc
tttggcctgcgatcctgtcctgacgatggcggggacgaagacgtaacagtcttaattcac
ccggtgggttacaatgaatccacggtggtcaggatccactctaaatgtgtctgcagctgt
ggagttacaaagcgttgcagcaacgacggccaatcgccatgcagcgggatgcaagatgag
gacagggggccaaatcatgaacttatggactcaaacaaaggttcaaacaggaactgcaga
ccagatgttgctgatgtagactgcagtggtcggggagtgtgtgagtgtgggaggtgtgtg
tgtgataggagcaaacttggggcagtgtatgggaaatactgtgagatagatgacttctcc
tgcccctaccatgagggcctgtcgtgtggaggacgaggtgcgtgtgtgtccagcgaatgt
gtgtgcaccgatggctggacaggtgagagctgcagttgccccatctccacggcaacctgt
caatcagccagcggctcgctgtgtagcggacgcggtcgatgcgtgtgtggaaagtgcgca
tgtgatgaccctcagtactctggagatttctgcgagacctgccctgcgtgccaaagcccc
tgtcaatcacactggaagtgtgtagattgccacttgtcacatggtctggctccaaaagag
gcgggacactgcaacagcacatgcatcccattggtgggttacgtggacgatacttcagag
tgtgccagcagcagccggatggtcgggacattcctgagcgtgtgtgctttgacggtgctc
tgtgggctggtcgtggtggccttctccaggcttctgctgcagaagagaatcaggacaccg
gcaggcgctggtgaagatggagtctttcactgcactggaaaggacctttcctacattcca
acaaccaatgaaaagacagtaacctacaggagggacaacccgcctgaccactccctggag
atgcacatccaggtgcccaagatgcctctcggtgacccctggcagttctaa

DBGET integrated database retrieval system