KEGG   Takifugu rubripes (torafugu): 101077517Help
Entry
101077517         CDS       T02386                                 

Definition
D-amino-acid oxidase-like
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101077517
   00330 Arginine and proline metabolism
    101077517
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    101077517
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    101077517
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101077517
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     101077517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 345 aa AA seqDB search
MRVAVIGAGVIGLSTAQSIYEKHHSAVRPLTIEVYADCFTPLTTSDGAAGFWQPYLYDKG
NVQETKWCKDTFDYLLSHLSSPESVKMGIFLQSGYNLLTEPGPEPSFKDSVLGFRQLTER
ELQMFPGYSYGWFNTALMVEGKTYLPWLMKWLQERGVKFYQRKIESFRELAESGVDVIVN
CTGMRAGDLQPDPELKPGRGQIIKVNAPWLKHWILTHDERKGVYNSPYIIPGSTQVTVGG
VFQIGNWNEHNTSVDHKEIWEKACQLEPSLKHATIVGDWTGLRPYRSKVRLERETIDCGP
TTVEVIHNYGHGGFGLTIHRGCAQEAARIFGQIVRHKGKGLKARL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggcggtcattggagccggggtcatcggcctgtcgacggctcagagcatctat
gagaagcaccactcggccgtccgcccgctgaccatcgaggtctacgcagactgtttcacg
ccactgaccaccagtgatggagctgctggcttctggcagccgtatctctatgacaagggg
aacgtgcaggaaacgaaatggtgcaaagacaccttcgactacctgctgagtcacctcagc
tcaccagagtcggtgaaaatgggcatatttctgcagtctggttacaacctgctgactgaa
cctggtccagagccctcattcaaagacagtgtcctgggcttcaggcagctcacggagcgg
gagctgcagatgttccccggatactcctacgggtggttcaacacagctctcatggtggaa
ggcaagacttatttaccttggctgatgaaatggttgcaagagaggggagtgaaattctac
cagaggaaaatagaatctttccgagagctggcagaaagcggcgtggatgtgatcgtcaac
tgcacggggatgagagcgggagacctgcagccagaccctgaactcaaaccaggacgtggt
cagataataaaggtgaacgctccttggctcaagcattggattttgacccatgatgaaaga
aagggggtctacaatagcccgtacatcattccaggaagcacccaggtgaccgtcggtggt
gttttccagattggaaactggaatgaacacaacacttccgtagatcataaggaaatctgg
gaaaaagcctgtcagcttgaaccgagtctaaagcatgccactatcgtcggggattggacc
ggcctcaggccttatcgcagcaaagtcagactggagagggagaccatcgactgtggtcca
accacagtggaggttatacacaactacggtcacggaggttttgggctgaccatccacaga
ggctgcgcccaggaagcagccaggatctttggccagatcgtccgacataaaggcaaaggc
ctcaaagctcgcttgtaa

DBGET integrated database retrieval system