KEGG   Takifugu rubripes (torafugu): 101077561Help
Entry
101077561         CDS       T02386                                 

Definition
filamin-C-like
Orthology
K04437  
filamin
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101077561
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101077561
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101077561
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101077561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 2704 aa AA seqDB search
MMSNNYDEQQPPQYYQATDFGEEEDEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
NKTITDLQREFTDGLKLISLLEVLSQKKMYRKYHTRPNFRQMKLENVSVALEFLERERIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEETKKLTPKQRLLGWIQNKV
PQLPINNFNRDWQDGKALGALVDNCAPGLCPDWADWDPNEPVQNAREAMQQADDWLGVPQ
VIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPLRPKQLFPNKVKAYGPGIEPHGNKVL
QPAVFTVDTAEAGSGEVLVYVEDPEGHTEEAKVKPNKDKSRTYTVTYVPKVEGVHKVKVL
FAGQAIDKSPYTVNVAKDMGDPSKVHARGPGLDPVGNVANKPTYFDIYTAGAGNGDISVV
IIDPQGKKDTVELILENKGDSVFRCTYRPVLEGPHTIHVLFAEQEIPKSPYTVNIAEAVN
PNACRATGRGLQPKGVRVKEVADFKVFTKGAGSGELKVSVKGPTGAEEQVKVQDAGNGVY
NCEYYPLKPGKYTVSITWGGHPIPRSPFEVEVGGEAGFQKVRAWGPGLKTGMVGKSADFV
VEAIGTDVGTLGFSIEGPSQAKIECDDKGDGSCDVHYWPTEPGDYAVHVICDDEDIKDSP
FIAHILPAANDTFPEKVKAYGPGLKPTGVTVNKPTEFTIDARMAGKGQLKIYAQDAEGCT
IDIKITDKRDGTYLCVYTPVKPIKHTIIITWGEVNVPNSPFRVLVGEGSHPDKVKVYGPG
VEKTGLKANEPTYFTVDCGEAGQGDISIGIKCAPGVVGPGEADIDFDIIKNDNDTFTVKY
TPPAPGRYTIMVLFAEQEIPISPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGTPTHFTIY
TKGAGKAKPEVHFAASRPGEAVRDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPIPK
SPFHITVAPPLDIGKVKVDGLDNKVEVGKDQEFTVNTKGAGGQGNVGVKMTSPSGRPIPC
KLESDKAKGIHSVKYIPPEEGHYKVDVSYDGNPVMGSPFGVEAVMPADPSKVRAFGPGLQ
GGIVGKPAPFTIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGSCSVYYLPTEPGEYAINI
LFADQHIPGSPFKAPVRMALDPSKVTASGPGLERAKAGEPATFTVDCTRAGEAELTIEIV
SETGAKAEVHIQKTAEGTFSVTYIPPFHGAHTITIKYGGHMIPHFPKVLQVDPSVDTSGV
HVYGPGVEPRGVLRDVTTHFIVDAHALKKAGGNHVKVHVINPSGTKTESYITDKGDGTYR
VEYTAFEDGIHLIEVLYDDVPVPKSPFRVSVVEGCDPSRVRAFGPGLEGGITNKANCFTV
ETRGAGTGGLGLTIEGASEAKISCKDNKDGSCSVEYIPFTPGDYDVNITYGGHPIPGSPF
RVPVKDPVDPSKVKCSGPGLGTGVRAHVPQTFTVDCTQAGQAPLDVKLYGPTGTAEPVGV
KNNGDGTHTVHYTPAQDGPYAVAVKYAEQEVPHSPFKVMSQPGHDASKVRASGPGLDTKG
VSASLPVEFTIDARDAGEGLLTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTIT
IKYGGDEIPYSPYRIQSLPTGDASKCLLTVSIGGHGVSNLQKLQTSEDTVITVDAKAAGK
GKVTCKVQTPQGMELDMDVVENRDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFHVVAT
NEPVVPRDTVDPLFRPVNFLVPFTPHQGEITGEVRMPSGKTARSHITDNKDGTITIKYQP
TERGLHEMDIKYEGNHIPGSPLQFYVDAVNTGVVTAYGPGLSYGMVNKAATFTVVTKNAG
EGGLSLAVEGPSKAEITCKDNKDGTCLVSYLPTAPGDYNIIVKFDNKHIPGSPFTAKITG
DDTITRTSQLNVGTSTDVSLKITETDLSSLTASIRAPSGNEEPCLLKKLPNRHLGISFTP
KEVGEHEVSVRKNGIHVANSPFKIMVGQSEIGEASRVKAFGKGLVEAHTSEMAEFFVDTR
NAGYGGLALSVEGPSKVDINCEDMEDRTCKVTYCPTEPGNYNVNIKFAEKHIPGSPFTVK
VTGEGRIRESITRKRQASSLASVGSTCGLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTR
TERTEISKTRAGETKREVRVEESTQVGGGGSPFRDVFGDFLGRESLSSFAGITARPEVEC
GPQTMTAQVTSPGGKTVDADIVDGGNSTYSVRFIPQEMGPHTVNVKYRGQHVPGSPFQFT
VGPMGEGGAHKVRAGGPGLERGVAAAPSEFSIWTREAGAGGLSIAVEGPSKAEISFEDRK
DGSCGVSYIVKEPGDYEVSIKFNNEHIPDSPFIVPIATLSDEARRLTVTSLQEKDLKVNQ
EASFMVQRNGARGVVDAKVHTPSGSSEECYVTELDSDKNAIRFIPRENGVHSIDVKFNGC
HIPGSPFNVRVGDPGLIGDPGMVTAHGPGLQGGTTGVPSEFVVKTCNAGSGTLSVNIDGP
SKVKLDCRECPEGFKITYTPMAPGNYLITIKYGGPQHIVGSPFKAKITGARLSGGHSLHE
TSSVLVETVTKTTKVGGAYSSSSSTSATKLTSDASKVVCRGTGLSKALVGQKNNFTVDCS
KAGTNMLMVGVHGPHAPCEEVYVKHMGNKLYNVTYAIKDKGSYQIIVKWGDDNVPGSPYK
VVAP
NT seq 8115 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcaacaactacgatgagcagcagcccccgcagtactaccaggccactgacttt
ggggaagaggaggacgaggagatgccggccacggagaaggacttggccgaggacgcgccc
tggaagaaaatccaacagaacaccttcaccaggtggtgcaacgagcacctgaaatgcgtc
aacaagaccatcaccgacctgcagagggaattcaccgatgggctcaagttgatctctctc
ctcgaagtgttgagccagaagaagatgtacagaaagtaccacaccagacccaactttaga
cagatgaagctggagaatgtttcggtggcgctggaattcctggagagggagcgcatcaag
ctggtctctatagatagcaaagccattgtggatgggaatctaaagctgatcctgggtctt
atctggactctcatcctgcactactccatttccatgcccatgtgggacgacgaggacgac
gaggagaccaagaagctgacgcccaaacagcgcctgctgggctggattcagaacaaggtg
ccccagctgcccattaataacttcaaccgcgactggcaggatgggaaggcgctgggagcc
ctggtggacaactgcgcccctggtttgtgtcctgattgggcagactgggacccaaatgag
cctgtgcagaatgcgagagaagccatgcaacaggctgacgactggttgggcgtgcctcag
gtaatcgcccctgaggagattgtggatccagatgtggacgagcactctgtgatgacatac
ctgtctcagtttcccaaagccaagctgaagcctggagctcctctcaggcccaagcagctc
ttcccaaacaaagtcaaagcgtatggacctggtattgagcctcacggcaacaaggtgctg
cagccggctgtgttcactgtagacaccgcggaagctggcagcggtgaagtcctcgtctat
gtggaggatcctgaaggacatacagaggaggctaaggtcaaacccaacaaagataaaagt
agaacctacacggtcacatatgttccaaaggttgaaggtgttcacaaggtgaaggtgctg
tttgctggccaggctatcgacaagagtccctacacggtcaatgtagctaaagatatgggt
gaccccagcaaggtgcatgccagggggccaggtttggaccccgtaggaaatgtggccaac
aaacccacctacttcgacatctacactgctggtgcaggaaatggagacatcagtgtggtc
ataatcgatcctcagggcaaaaaggacacggtggagctcatccttgagaataagggcgac
agcgtgttccgctgcacgtaccgtcctgtgctggaaggccctcacaccatccacgttctg
tttgcagagcaggaaatccccaagagcccttacactgtcaacatcgctgaagctgtgaac
ccgaacgcctgcagagcgacgggaagaggccttcagccgaaaggtgtgagagtaaaggag
gttgcagacttcaaagttttcactaaaggagctggcagcggcgagctaaaagtctctgtc
aaaggaccaactggagcggaggagcaagtgaaagtgcaagatgcaggaaatggtgtctat
aactgtgaatactacccactcaaacctggtaaatacactgtcagcatcacctggggaggc
catcccatcccacgcagcccgtttgaagtagaagtgggtggggaggcaggttttcagaag
gtgagagcctggggtcctggtctgaagacaggcatggttgggaaatctgccgactttgtg
gtggaggcgatcggcacagatgtcggaactctgggtttttccattgaaggcccatcacag
gctaaaattgaatgtgacgacaaaggcgacggctcctgcgacgtgcactactggcccacc
gagcccggcgactatgccgtgcacgttatttgcgacgacgaggacattaaagacagccca
ttcattgctcacatccttcctgctgccaatgacactttcccagaaaaggtgaaagcctac
ggtccaggtcttaaacccaccggcgtcactgtgaacaaaccaactgaattcaccatcgat
gcccgcatggcaggaaaagggcaactcaagatttatgcccaggatgctgaaggctgcacc
atcgacattaaaattacagacaaaagggatggcacttacctgtgtgtgtacactccagtc
aaacctatcaagcacaccatcatcatcacctggggagaggtcaatgtgcccaacagcccc
ttcagggtgctggttggcgagggttctcatccagacaaagtcaaggtctatgggcctgga
gtggagaagactgggctcaaggctaacgaacccacctacttcaccgtggactgcggagaa
gccggtcaaggggacatcagcatcggaatcaagtgcgccccaggggtggtcggccctggc
gaggccgacatcgactttgacatcatcaagaatgacaatgacaccttcactgtcaagtac
acgccccctgcgccgggcagatacaccatcatggtgctgtttgcagagcaggaaattccc
atcagcccattcaaagtaaaagtagacccgtcgcacgatgctggcaaagtgagggcagag
ggtcccggactcaacaagacaggagtggaggtgggcactccaacccacttcaccatctac
acaaagggagctggcaaggccaagccagaggtgcattttgcagcatcgaggccgggagag
gcggttcgtgactttgagatcatcgataaccacgactactcctacactgtcaagtacaca
gctcttcaacagggtaacatgtcaatttccgtcactcacggaggcgatcccattcccaag
agtccctttcatatcaccgtggcgccacctctggatatcggaaaggtgaaagtggacgga
ttagacaacaaagtggaggttggaaaggatcaggagttcacggttaacacaaagggtgcc
ggagggcagggcaatgttggtgtgaaaatgacctcaccgtctggccgtccaatcccatgt
aagctggagtcagacaaagccaagggcattcacagtgtgaagtatattcccccagaggag
gggcattacaaggttgatgtcagctatgatggaaatccagtgatgggaagcccttttggg
gttgaagcagtgatgcctgctgatccttcaaaggtgcgagcctttggtccgggccttcag
ggaggaattgtgggcaaaccagccccttttactatcgacaccaaaggtgctggtgcaggc
gggttgggcctgactgtggaaggtccatgcgaagccaaaatcgagtgccaggacaacggc
gatggctcgtgctcagtttattacctgcccacagagcctggcgagtacgccatcaacatt
ctatttgcagaccagcacattcctggctctcccttcaaggctccagtgcgcatggctttg
gaccccagcaaggtgacagctagcgggcccggcctggagagggccaaggcaggtgaacca
gcgaccttcactgtggactgcacccgggccggcgaagccgagctcaccattgagattgtg
tcagagaccggggctaaagcggaggtgcacattcagaagactgcagaggggaccttctct
gttacatacatcccacctttccacggagcacacaccatcaccatcaagtacggcggccat
atgattccccattttccaaaggtgctgcaggtggatccgtctgtggacaccagtggagtg
cacgtctatggcccaggagtggagcccagaggggtcctcagagatgtcacaacccacttc
atcgtcgatgcccacgctctcaagaaggctggaggaaatcacgttaaggtgcacgttatc
aatccctctggcaccaaaacagaaagttacatcacggacaaaggagacggcacctacaga
gtggagtacacagcttttgaggacggaatccatcttattgaggtgctctatgatgacgtg
cctgtcccaaagagccctttcagagtatctgtggtggagggatgtgatcctagcagggtc
cgcgcctttgggcccggtttggaaggaggaattaccaacaaggcaaactgcttcaccgtg
gagacgagaggagccggtacaggaggtctggggctgaccatcgagggagcatcagaggca
aaaatatcatgcaaagacaacaaggatggcagctgcagtgtggagtacatccccttcacc
cccggagactacgacgtcaacattacctacggaggtcaccccatccctggcagcccattc
cgtgttccagtgaaggaccctgtggatcccagcaaggtgaaatgctcaggtccaggtctg
ggcacaggagtgagagctcacgttcctcagactttcacagtagactgtacccaggccgga
caggcccctctggatgtcaaactctatggcccaacaggcactgcagagccagttggtgtg
aaaaacaatggcgatggcactcatacagttcattacaccccagctcaggatggtccttac
gctgtcgccgtcaaatatgcagagcaggaggtcccgcacagtccattcaaggtaatgtct
cagcccgggcacgacgccagtaaagtgcgtgcaagcggccctggactggacacaaaaggc
gtgtctgcgagtctgcctgtggagttcactattgatgcccgtgatgccggagaaggactg
ctcactgtgcagattctggacccggagggcaaaccaaagaatgccaccatccaggacaac
agggacggcacctacacggtctcctatgtgccggactcaacgggcccgtacacaatcacc
attaaatatggaggagatgagattccttattctccataccgcattcagtctctgcccact
ggagatgccagcaaatgtctcctgacagtttctatcggagggcacggcgtgtcgaacctg
cagaagctgcagacctcagaggatacagttattacagtggatgccaaggctgctgggaag
ggcaaggtgacctgcaaggtgcagacgccacaggggatggagctggacatggatgtggtg
gagaatcgtgatgggacctttgacatttactacaccgcccctgagcctgggaaatatgtt
attaccatccgttttggaggccagaacatccctaaaagccccttccatgtggtggccaca
aatgagcccgtcgttccccgcgatactgtcgatcctctcttccgtcccgttaacttcctc
gtccccttcacgccacaccaaggagaaatcacaggtgaagtgcgaatgccttcaggcaag
accgcccgctcgcatatcactgacaacaaggacggcacaatcaccatcaagtaccagccc
accgagagaggcctgcacgagatggacatcaagtatgaagggaatcacatcccaggaagc
cctctgcagttctatgtggacgccgtaaacaccggagtggtgactgcctacggtcccggt
ctgagttacggcatggtgaacaaggccgccaccttcacggtcgtcaccaaaaatgcagga
gaaggtggtctgtcactggccgtggaaggtccctcaaaggctgagatcacctgcaaggac
aacaaagatggcacctgcctggtgtcctatctgcccacagcccctggagactacaacatc
atcgtcaagtttgacaacaagcacattcccggcagtccgtttactgccaagatcactggc
gatgacacgataaccaggacatcccagctgaatgtcggcacctcgactgatgtgtccctt
aagattacagagaccgatttgagctctctgaccgccagtatcagagcgccgtcgggcaac
gaggagccctgtctgctcaagaagctgccaaacagacaccttggtatctctttcactccc
aaggaggtcggcgagcacgaagtgagcgtgaggaagaacggcatccacgtggccaacagc
ccgtttaaaatcatggttggtcagtcagagatcggcgaggccagcagagtcaaggcgttc
ggcaaaggtctggtggaggcacacacatctgaaatggccgaattctttgtggatacgagg
aacgcaggttacggaggacttgcgttgtcagttgagggtccaagcaaagtggatataaac
tgtgaagacatggaagacaggacatgcaaagtgacgtactgtccaacagaacctgggaat
tataatgttaacatcaagtttgctgaaaagcacatcccaggaagtccttttacagtgaag
gtgactggagaaggtcggatcagagagagtattaccaggaaaaggcaggcatcgtctctt
gcctcagtgggcagcacctgtggccttaacctcaaaatcccaggaaactggttccagatg
gtttcggctcaggagaggctgaccaggactttcacccgcagcagccacacctacacccgc
acagagcgcacagagatcagcaaaacccgcgccggggagacaaagagggaggtccgagta
gaggaaagcacccaggtgggtggaggaggaagcccctttagagatgtttttggagacttt
cttggcagagagagcttaagcagcttcgccggcatcactgccagaccagaggttgagtgc
ggtcctcagaccatgacggctcaggtcaccagccctggtgggaaaaccgtggatgcggac
atcgtggatggagggaacagcacctacagtgttcgcttcatccctcaggaaatgggaccc
cacactgtcaacgtcaagtacagaggtcaacacgtccccggcagccccttccagttcact
gtagggcccatgggtgagggaggggcacacaaggtccgtgctggagggccgggtctggag
agaggtgtagctgcagctccctctgaatttagcatctggaccagagaggctggtgctggt
ggcctttccattgcagtagaaggtccaagcaaagctgagatctcatttgaggacagaaag
gatggttcctgtggcgtctcctacatagtcaaagaaccaggcgactacgaggtgtcaatc
aagttcaacaacgagcacatccccgacagtccgttcatcgttccaatcgctactttgtcg
gacgaggcccgcaggctcactgtcacgagccttcaggagaaagatttgaaggtaaaccag
gaggcgtccttcatggtgcagcgcaacggggctcgaggcgtcgtcgacgccaaagttcac
actccatctggctcctcggaggaatgctatgtcaccgagctcgacagcgacaagaacgcg
atccgcttcattccacgggagaacggagtgcattccattgatgtcaagttcaatgggtgc
cacattcccggaagcccctttaatgtgcgggtgggagaccccggtctgatcggagaccca
ggcatggtgacggcacacggccctggactgcagggaggaaccacaggcgtgccttcggaa
tttgtagtcaaaacttgcaatgccggctctggcactctgtccgtgaacatcgacgggccg
tccaaagtcaaactggactgtcgggagtgtccggagggcttcaagatcacttacacgccc
atggcgcctggaaactatctcatcaccatcaaatacggaggaccgcagcacatagtgggc
agcccgttcaaagctaaaatcacaggtgctcggctgtcggggggacacagcctccacgaa
acctcctcagttttggtggaaacggtcaccaagacgactaaagtgggtggtgcctacagc
tcttcctcctccacctccgctacaaaactgacctcagacgccagcaaggtcgtctgtcgt
ggaacggggctgtccaaggctttggtcggacagaaaaacaattttacagttgactgcagc
aaagcaggtaccaacatgctgatggtaggtgtgcacggaccccatgccccctgcgaggag
gtctatgtcaagcatatgggcaacaagctttataatgtcacctacgccatcaaggacaag
ggcagctaccagatcatcgtcaaatggggtgatgacaatgttcccgggagtccgtacaaa
gtggtcgcgccctaa

DBGET integrated database retrieval system