KEGG   Takifugu rubripes (torafugu): 101077590Help
Entry
101077590         CDS       T02386                                 

Definition
NAD-dependent protein deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101077590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 348 aa AA seqDB search
MSVNYAAGLSPYADKGVCGLPEEFDSAEEVKAKVEILAQLIKDSRHLVVHSGAGISTSSG
IPDFRGPKGVWTLEEKGESPQFETTFEAARPSLTHMALLGLQRAGYLKYLISQNVDGLHV
RSGFPRDMLSELHGNMFVEECEKCGRQYVRDKVIGVMGLKPTGRLCDVVRSRGLRACRGK
LISTILDWEDALPDRDLNKAEEASRQADLALTLGTSMQIKPSGDLPLITKRKGGKLAIVN
LQPTKHDKHSYLRIHGYVDDIMKHLMELLGLDIPKWEGPTICQSSTRTSECKADVKPHQS
VTVGVKVKKEVRKREAEALMDTGDIKDEVLLKKEKAESPEADEENKSL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaattatgcagccgggctttcgccgtacgcagataaaggtgtctgtggtctt
cccgaggagtttgatagtgctgaggaagttaaggcaaaggtggagatccttgcccagcta
ataaaagattctcggcacttggttgtccactctggagcaggaataagcacctcatcggga
atcccagacttcagagggccaaagggtgtgtggacgttggaggagaagggcgaatcgcct
cagtttgaaacgacgtttgaggctgcccgacccagcttaactcacatggctctcctggga
ctgcagagggccggctatctcaagtacctcatcagccagaacgtggacggcctgcatgtc
cggtcaggatttccccgagacatgctgtcagagcttcatggaaacatgttcgtggaggag
tgtgagaagtgtggcaggcagtacgtgagagataaagtgattggtgtcatgggcctgaaa
ccaacggggcggctctgcgatgtggtgcgatccaggggcctaagagcctgcaggggaaag
ctgataagcactatactggactgggaggatgctttgcccgatagagacctgaacaaggca
gaagaagccagtagacaagcggatctggctctgacgctgggcacatccatgcagatcaaa
cccagcggagacctgcccctcatcacgaagcgcaagggaggaaagctggccattgtcaac
ctacagcccacaaagcacgacaagcattcatacctgcgtatccatggttatgtagatgat
ataatgaaacatctgatggagctgctgggattggacattccaaagtgggaggggccaacc
atctgccagagttccacaagaacgtcggagtgcaaagctgatgtcaaaccacatcagtcg
gttactgttggcgtgaaggtgaaaaaggaggtgaggaaacgagaagcagaggcgttaatg
gacactggggacattaaggacgaggttttgttgaagaaggagaaagcagagtctcctgag
gcagatgaagaaaacaagtctttataa

DBGET integrated database retrieval system