KEGG   Takifugu rubripes (torafugu): 101077743Help
Entry
101077743         CDS       T02386                                 

Definition
acetyl-CoA carboxylase 2-like
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tru01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tru00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tru00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:tru00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:tru04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 2304 aa AA seqDB search
MRERLKFILGASEDNSSDDEPMADKPPSGAPQPLTNALSPQQTTSARLTRALHCRPSMSG
LHLVKKGREHRKMDLQRDFTVASPAEFVTRFGGTRVIEKVLIANNGIAAVKCMRSIRRWA
YEMFRNERTIRFVVMVSPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIP
VQAVWAGWGHASENPKLPELLNKAGISFLGPSSKAMWALGDKVASSIVAQTAGIPTLPWS
GSGLRVDWVEEDQTQGIMISVPSEIYSKGCVQDVDEGLAGAEEIGYPVVIKASEGGGGKG
IRKVESSEDFPGFFRQVQTEVPGSPIFIMQLAQHARHLEVQILADEYGNAISLFGRDCSI
QRRHQKIIEEAPATIAAPSTFEQMERFAVRLAKMVGYVSAGTVEYLFSEDGRFHFLELNP
RLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDLRLLYGEAPWGDSIINFDSPDCMPS
PRGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGATGGLHEFADSQFGHC
FSWGENREEAISNMVVAMKELSIRGDFRTTVEYLIKLLETESFRNNDIDTGWLDHLIAEK
VQAERPDTMLGIVCGALHVADASFRKSMSDFLHSLERGQVLPAASLLNSVNVDLIYDGVK
YCLKVARQSPTTYVIIMNGSDIEIDVHRLSDGGLLLSYDGSSHTTYMKEEVDSYRITVGN
KTCIFEKEKDPTVLRSPSAGKLLQYLVEDGTHICAGETYAEIEVMKMVMTLNVQQSGCVH
FVKRPGAVLKSGCILARMELDDPSSVLRVKLNTAVLPPQQPLPIIGEKLHQVFHSVLENL
VKVMDGYCLEEPYFSNKLKQWVATLMKTLRDPSLPLLELQEIMTSVAGRIPPSVEKDIRK
VMAQYASNITSVLCQFPSQKIANILDYHAATLQRKADREVFFMNTQSIVQLVQRYRSGIR
GYMKSVVLDVLKRYLQVETQFQQAHYDKCVINLREQYKPDMSPVLEYIFSHAQVSKKNIL
VTLLIDQLCGRDPTLADELMAILNELTQLSKMENSKVALRARQVLIASHLPSYELRHNQV
ESIFLSAIDMYGHQFCPENLKKLILSETSIFDVLPNFFYHINQVVCMAALEVYVRRAYIA
YELNSIQHHRLQDGTCAVDFQFMLPSSHPNRGSSRTLNRIPVPVSGPGQFEMRRQSSELF
LDGALSPPCQRMGAMVAFQCFDDFKRNFDEVLSSFAEPLLESASFSDSCSGLYDKENFKN
KRENPIHIINVSIKTADTEDDDALVTALTAFAQSKKAVLFEYGIRRVTFLIAQKREFPKF
FTFRARDAFQEDRIYRNLEPALAFQLELNRMKNFDLTAVPCENHKMHLYLGAARVQQGAE
VTDYRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFSNTSVRTDCNHIFL
NFVPTVIMDPSKIEQSVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPVRLFLTNE
SGYYLDISIYEEVTNTSSGQIMFHSYGNKQGPLHGMLINAPYVTKDLLQAKRFQAQTLGT
TYVYDFPEMFRQALFKLWGPGNGHPKDVLMCTELVLDPQGCLVQMNRLPGDNDVGMVAFR
MKMKTPEYPEGRDIIVICNDITHMIGSFGPQEDELFLKASALARAEGIPRIYIAANSGAR
IGLAEEIKHMFQVAWIDPRDPYKGFKYLYLTPQDYTRISSTNAVHCQHVEEDGESRYIIT
DVIGKDDGLGVENLRGSGTIAGESSQAYEEIITISMVTCRAIGIGAYLVRLGQRVIQVEN
SHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHTTVPDDFEGVFTILQWLSYMP
KNKQCPVPVIPTTDPVDREIEFIPTKAPYDPRWMLAGRPHPTVRGAWQSGFFDHGSFMEI
MSSWAQTVVVGRARLGGIPLGVIAVETRTVELTVPADPANLDSESRVLQQAGQVWFPDSA
FKTSQAISDFSHEHLPLMVFANWRGFSGGMKDMYDQILKFGAYIVDALRTFRQPVLVYIP
PHAELRGGSWVVIDPTINPLCMELYADRESRGGVLEAEGTVEIKYRRKDLLKTMRRLDSV
YAGLAEQLASPDLPDKECRELESKLKAREEFLLPIYHQVAVQFVELHDTPGRMQEKGVIT
DILDWKNVRSFFYWRLRRLLLEEVVKCEILQANKDLSDGHVQSMLRRWFVETEGTVKAYL
WDNNQAVVEWLEKHMSKEDGAPSAIRENMKYLKRENTLKLIRSLVQENPDITMDCIIHMS
QNITPSQRAKLLHLLTTMDNTSNS
NT seq 6915 nt NT seq  +upstreamnt  +downstreamnt
atgagggaacgcctcaagttcatcctgggagcatcagaggacaactcttcagacgacgaa
cccatggctgacaaaccccccagtggtgcgcctcagcctctgaccaacgcactctctccc
cagcagaccacctcagccaggttaacacgagctctccactgcaggcccagcatgtctggt
ctccacttggtgaagaaaggacgtgaacacagaaaaatggacctccagagggacttcacc
gtggcctcccctgctgagtttgtcacccgattcgggggtacccgtgtcattgagaaagta
ctaatagccaacaatggcatagctgcggtcaaatgcatgcgctccatccgtcgctgggcc
tacgagatgttccgcaatgaaaggaccatccgatttgtagtcatggtctcccctgaagac
ctgaaagccaacgcagaatacatcaaaatggctgaccattatgttcctgtacccggggga
cccaacaataacaactatgctaacgtagagctgatagtggacattgctaagagaatccct
gtgcaggccgtgtgggctggatggggccacgcatcagaaaaccccaaactgcctgaactg
ctgaacaaagcagggatttcgttcttagggccgtccagtaaagccatgtgggctctgggg
gacaaggtagcttcctctattgtggctcagactgccggcattcccactctaccgtggagt
ggatcagggctgagggtggactgggtcgaggaggaccagacacagggcatcatgatcagt
gttccttcagagatctactccaaaggctgtgtgcaggatgtcgacgagggcttggcagga
gctgaggaaattggctatccagtggtcatcaaggcttccgaaggaggaggtggaaagggc
atccggaaagtagaatcttcggaggatttcccaggtttctttagacaggttcagacagag
gttcctggctcacctatcttcatcatgcagctggctcagcacgcgagacaccttgaggtt
cagattcttgctgatgaatatggaaacgccatctctctgttcgggcgagactgctccatc
cagagaaggcaccagaagatcattgaggaggctcctgctaccatagcagctccgtccacc
tttgaacagatggaaaggtttgctgtgcgactagctaagatggtgggctacgtgagtgca
ggtactgtggaatacctcttctctgaagatggaaggttccatttcctggagctgaatcct
cgtctgcaggtggaacatccctgtactgaaatggtcgctgatgtaaaccttccagccgcc
caacttcagattgcaatgggcatccccctttatagaatcaaggacctccgcttgctttat
ggagaagcaccttggggtgacagcatcattaactttgacagtccagactgtatgccaagc
ccgagaggacatgtcatagctgctcggatcaccagtgagaacccagatgagggcttcaaa
cccagttcaggcaccgtccaagagctgaacttccgcagcagtaaaaacgtgtggggttat
ttcagcgtgggagcaactggtggacttcacgagtttgcggactcgcagtttggacactgt
ttctcctggggcgaaaaccgtgaagaggccatttcgaacatggtggtggcaatgaaggaa
ctgtccatcagaggggactttaggaccacggttgagtacctcattaaattactggagacg
gaaagcttcaggaacaacgacatcgataccggctggctggatcacctcatcgcagagaaa
gtgcaggcggagagaccagacaccatgctgggtattgtctgtggggctttacatgttgct
gatgccagcttcaggaagagcatgtccgacttcctgcactcactggaacgagggcaagtt
ctacctgctgccagcctcctcaactctgtcaatgttgatcttatatatgatggtgtcaag
tactgcctcaaggtagctcgtcagtccccaacaacatacgtcatcattatgaatggctcc
gacatcgagatagacgtccacaggctgagcgatggcggtcttctcctgtcctatgatggc
agcagtcacaccacctacatgaaagaggaggtggacagctaccgcatcactgtcggcaac
aagacttgcatatttgagaaggagaaagaccccacggtgctgaggtctccctctgctggc
aaactgctgcagtatttggtggaagatggaacccacatctgtgcaggagagacctatgca
gagattgaggtgatgaagatggtgatgacactgaacgtgcagcagtctggatgtgtccac
tttgtcaaaagacctggagctgttctcaagtctggctgtatcttggcccgtatggagctg
gatgatcccagcagtgtccttagagtgaaactcaacacagctgtgctgccaccccagcaa
ccgttgcccatcatcggggaaaagttgcaccaggtttttcacagtgtgttggaaaatttg
gttaaagtcatggatggatactgcctggaagaaccgtacttcagcaacaagctcaaacag
tgggtggccaccctgatgaagacattaagggacccctcgctgccactgttggaactccag
gagatcatgacgagtgtggccggtcggatccctcccagcgtggaaaaagacattcgtaaa
gtcatggctcagtatgccagcaacataacctctgtcctctgccagttcccgagccaaaag
attgcaaatattctggactatcatgcagcaaccctgcagaggaaggcagacagggaggtg
ttcttcatgaacacccagagtattgttcagcttgtgcagaggtaccgcagtggaatccgc
gggtacatgaagtctgtggtgctggatgtgctgaaacgatatcttcaagttgagacacaa
ttccagcaagctcactatgacaaatgtgtgatcaacctgagagagcagtacaagcctgac
atgagtccggtcctggagtacatcttctcccatgcccaggtgtccaagaagaacatctta
gtcacactgctcatagaccaactgtgtggtagagatccgaccctagcagacgagctgatg
gctatactgaatgaactcacacagctcagtaagatggagaactcaaaggtggccttaaga
gccagacaggtgctgatcgcttcccatttaccatcctacgagctgaggcacaatcaggtg
gaatccatcttcctgtccgccatcgacatgtacggacaccagttttgtccagagaacttg
aagaaactaattctgtcggaaacctccatttttgatgttttgcccaacttcttctatcac
atcaatcaagtggtctgcatggctgccttggaggtgtacgtgcggcgagcttacatcgcg
tatgagctgaacagcattcagcaccaccggctccaagacggaacgtgcgctgtagatttc
cagttcatgcttccatcgtcacatccaaacagagggagcagccgtactctgaacaggatt
cctgtcccggtcagtgggccaggccagtttgaaatgaggcggcagagcagcgagcttttc
ctggatggagctctgtcaccaccgtgccagcgcatgggagccatggtggctttccagtgt
ttcgatgacttcaaaaggaattttgacgaggtcctctccagctttgcggaaccgctgttg
gagagtgcgtccttctccgactcgtgttctggtctctacgataaggagaacttcaagaac
aaaagggagaacccgatccacatcattaacgtgtccataaaaacagcagacacggaggat
gacgacgccttggttacagcgttaactgccttcgcccagtcaaagaaagctgtcctcttt
gagtatggaatcagaagagtaacatttttaattgcacaaaagagagagtttcccaagttc
ttcacattccgagctagagatgcgtttcaggaagaccgcatttatcgtaacctggagcca
gctttagcctttcagttggagttaaaccgcatgaagaactttgacttgacggccgttccc
tgtgaaaaccacaagatgcacctctacctcggtgcagcccgcgtgcagcagggggctgag
gtcacggactaccgtttctttatacgtgccattattcgacactcggatctcatcacaaag
gaagcctcctttgagtaccttcaaaatgagggcgaacgtcttcttttggaggccatggat
gagttggaggtggcctttagcaacacaagtgtccgcacagactgcaaccacatcttcctc
aactttgtgccaactgtcattatggacccttctaaaatcgagcagtcggttcgctccatg
gtgatgcgctacggcagccgtctctggaagctccgggtcctgcaggccgaactgaagatc
aacatccgtctgacaccaaccgggaaggccattccagtccggctctttctcactaatgag
tcgggctattacttggacatcagcatctatgaggaggtcaccaacaccagttcaggccag
atcatgttccactcctatggaaataagcagggccctctgcatggcatgctgatcaacgcc
ccctatgtgaccaaagacctgctgcaggccaaacgcttccaggctcaaactctaggcact
acatatgtctatgatttccctgagatgttcagacaggcactgtttaagctgtggggtcca
gggaacggacaccctaaagatgttttgatgtgcactgagctggtcctggaccctcaaggt
tgtctggtgcagatgaaccgcctgccaggagataacgatgtaggaatggttgccttcaga
atgaagatgaagaccccggagtacccagagggccgggacatcattgttatctgtaatgac
atcactcacatgattggctcatttggacctcaagaggatgaacttttcctcaaggcttcg
gcgttagctcgagccgaggggattccccgtatttacatagctgctaacagcggcgctcgc
attggcctagctgaggagatcaaacacatgttccaggtggcctggatcgatcccagggat
ccctacaagggtttcaagtacctttacctcacaccacaagactacacacgcatcagctca
accaacgctgtgcactgtcaacatgtagaggaagatggagagtccaggtacatcatcact
gatgttatcgggaaggacgacggtctcggggttgagaacctgcgaggttctggaaccatt
gctggagagtcgtctcaggcctatgaggagatcatcacaattagcatggttacgtgtcga
gctattggaattggagcctatctggtccgactgggacagagagtgattcaggtggagaac
tctcacattatcttgactggagcaggtgcccttaacaaggttttgggccgagaagtttat
acttccaacaaccagttgggagggatccaaatcatgcacaataatggagtcacacacacc
acagtgccagatgactttgagggcgtcttcaccatcctccagtggctctcctacatgccg
aagaacaagcagtgccctgttcccgttataccgaccacagatcccgtggacagagagata
gaatttattcctacaaaagctccatatgacccccgctggatgctggcagggagacctcac
cccacggtaagaggcgcctggcaaagcggtttctttgatcacggctctttcatggagatc
atgagctcctgggctcagacagtggtggtaggcagagcacggttaggaggaattcctctt
ggtgtgattgctgttgaaacacgcacagttgagttaacagtgccagcagatccagcaaac
ctggattcagaatctagagtcctgcagcaggccggtcaggtgtggttcccagattcagcc
tttaaaacctctcaggccatttctgacttcagccatgagcatctgcccctgatggttttt
gccaactggaggggcttttctggtggaatgaaagatatgtatgaccagatattaaagttt
ggggcctacatcgtggatgcccttcgcactttccgtcagccggtgctggtttacatcccc
ccgcatgcagaactgagaggaggttcctgggtcgtgattgatcccactattaaccctctg
tgtatggagctctatgccgacagggagagcagaggtggtgtgctggaggctgaaggaacg
gtggagatcaaatacaggagaaaggatctactgaagactatgagaaggctcgactcagtc
tatgctggtcttgctgaacagcttgcttccccagatctgcctgacaaagagtgcagagag
ctggagtccaagttgaaagcacgggaggagttcctgttgccaatctaccaccaggtggca
gtgcagtttgtcgagcttcacgacactccaggcaggatgcaggagaagggcgtcatcact
gatattttggattggaagaatgtgcggtccttcttctactggcgtctccgtcgcctcctg
ttggaggaggtggtgaagtgtgagatcctgcaggcaaacaaggacctcagtgatggacac
gtgcagtccatgctgcgccgctggtttgttgagaccgagggaacagttaaggcctacctc
tgggataataaccaagcagtagttgagtggctcgagaagcatatgtccaaagaggatggt
gctccttctgcaatccgagagaacatgaagtatctgaaaagagaaaacactttgaagcta
atccgcagcctcgtgcaggagaatcctgacataaccatggactgcatcatacatatgagc
cagaacatcactccatcccagagggccaagctcttgcaccttctcacaactatggacaac
accagcaacagttaa

DBGET integrated database retrieval system