KEGG   Takifugu rubripes (torafugu): 101077804Help
Entry
101077804         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 15-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101077804
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101077804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 1015 aa AA seqDB search
MAEGGAADLETQRGEIAALLKTQLRKGDTWYLVVSHWFKQWKKYVGFDNWDKYQMGEQDV
YPGPVDNSGLLRDGDVLAIKEHLIDELDYILVPTEGWNKLVSWYGLTEGQEPIARKVVEQ
GMFVKHCKVEVFLTELKLCRDSNMDNVITRRFSKADTIDMIEHEMRKLFSIPDEKETRLW
NRYMTNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGSGSTAPKSSGASNLSAL
PKISPSSLTNNHNSSFNSRNVKNSSFSLPSYHNSYDYSDQSRPSERSGLCGLSNLGNTCF
MNSAVQCLSNIPPLTEYFLKDKYTDELNEDNPLGMKGEIARAYAELIKQIWSGKYSYVTP
RPFKTQVGRFAPQFSGYQQQDSHELLAFLLDGLHEDLNRIRKKPYIQLKDANGRPDKVVA
EEAWENHIKRNDSIIVDIFHGLFKSTLVCPVCSKVSVTFDPFCYLTLPLPMKKERTLEVY
LVRLDPLAKPTQYKLTVPKVGYISDLCTSLSYLSGVPADKMIVTDICNHCFHRIFATNEN
LSSIIERDDIYVFELPVNRVEDTDHVVIPVHLREKYKQSGYNHTSTTLFGQPFLIAVPRT
LSEDKFYNMLLLRLCRFVKSPVEEDEQDCEETQASKQHTLNGNATNGMLEEGSPSEMETD
EQDDESSQDQELPSENDNSQSEDSVGGDNELENGMGCPQNSTKAPQTAGHNRKRLFTFQF
NNMGKTDHSIIKEDTRQIRFDEGHLRLSDRSYLSLDWEPETKKKYFDETVVEDFDKHESM
DYKPQKKAFFKLKDCIELFTTKEKLGAEDPWYCPNCKQHQQATKKLDLWSLPPVLVVHLK
RFSYSRYMRDKLDSLVDFPLRDLDMSEFLINPNAGPCRYDLIAVSNHYGGMGGGHYTAYA
KNKDDGKWYYFDDSSVSPASEDQIVSKAGYVLFYQRQDTVKGTGYFALDREEEEEEEEEE
EEEEEEDTEGIVRAESAAAQGDEEDLNENRCRKNDNEQEGEEEEAPDRDVAMKTN
NT seq 3048 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggaggagcggctgatctggaaacccagcgaggagagatcgcggcattgttg
aaaacacaactcagaaagggagacacttggtacctggtagttagtcactggttcaaacag
tggaagaaatatgttggatttgataattgggataaataccagatgggggaacaggatgtc
tacccaggtcccgtcgataactctggacttctcagagatggggatgtcctggccatcaag
gagcacctcattgatgagctcgactacatcttggttcctacagagggctggaataagctt
gtcagctggtatggactaacagagggccaggagccaattgcacgcaaggttgttgaacag
ggtatgtttgtgaagcactgcaaggtggaggtgttcctgacagagctgaagctgtgcaga
gacagcaacatggataacgtgatcaccagacgcttcagtaaagctgacacgatagacatg
atagagcatgagatgcggaagctgttcagcatccccgatgagaaggagaccagactgtgg
aacaggtacatgaccaacacctttgagcctctcaacaaaccagacagcaccattcaagac
gccgggctgtatcaaggacaggttcttgttatagagcagaagaatgaggatggcacctgg
cccagaggctctggctccacagcaccaaagtcatctggtgcttccaatctctctgctttg
ccaaagatctcgccttcatctctcacaaacaatcataacagcagcttcaacagcaggaat
gtgaagaactcgagctttagtctaccatcataccacaacagctatgactactctgaccag
agccggccgagcgagcgctcgggcctctgtgggctctccaacctgggcaacacctgcttc
atgaactcagccgtacagtgtttaagtaatatccctccactcacggagtacttcctcaaa
gacaagtacacggatgaactgaatgaggacaacccactgggcatgaagggggagatcgcc
agggcctacgctgagctcatcaaacagatttggtcaggcaaatacagctatgtcaccccg
aggcctttcaagacccaggtcgggcgttttgcgcctcagttctcaggctaccaacagcag
gattctcacgagctcttggcttttcttctcgatggccttcacgaggatttgaaccgcatc
agaaagaaaccctacatccagctcaaggatgctaatggcaggcccgataaggtggtggca
gaggaggcgtgggagaaccacatcaagagaaacgactccatcatcgtagacattttccac
ggtctcttcaagtccactctggtgtgtcccgtctgctccaaagtttctgtgacgtttgat
cccttttgctacctgacgctcccgctgcccatgaagaaggagcgcacgctggaggtctac
ctggtcagactggaccctctcgccaaacccacgcagtacaaactgactgtgccaaaggtg
ggctacatttctgacctgtgtacctccctctcttacctgtctggggtccctgctgacaag
atgattgtgactgacatctgtaatcactgtttccaccgaatctttgccaccaacgagaac
ctgagcagcatcattgagagagatgacatctatgtatttgagctcccggtcaacagagtg
gaggacacggaccacgtagtgatcccagtgcatttgagggagaagtacaaacagtccggt
tacaaccacaccagcacaacgctgttcgggcaacccttcctcatcgccgttcccagaaca
cttagcgaagacaaattctacaacatgctgctgctgcgcctctgtcgctttgttaaatct
ccggtggaggaggatgaacaggactgtgaggagacgcaggcctctaagcagcacactctt
aatggaaacgccactaatggaatgctggaagaggggtcaccgagcgagatggagactgac
gagcaggacgatgagtccagccaggaccaggagctgccctccgagaacgacaacagccag
tcggaggactctgtgggcggggacaacgagctggagaacggaatgggctgtccccagaac
tccaccaaagcgccgcagacggccggccacaacagaaagagactttttacattccagttc
aacaatatgggaaaaacagaccactccatcatcaaggaggacacgaggcagatccgcttc
gacgagggccacctccggctgagcgaccgctcttatctttcactcgactgggaaccagaa
actaagaagaaatattttgacgagactgttgtcgaggactttgacaagcacgagagcatg
gattacaaacctcagaagaaggctttcttcaagctgaaggactgcatcgagctgttcacc
accaaggaaaaactgggcgcggaggatccgtggtattgtccaaactgcaagcagcaccaa
caggccaccaagaagctggacctgtggtctctgccgccggtgctggtggtccacctgaaa
cgcttctcctacagccgctacatgagggataaactggactcccttgttgatttcccactc
cgcgatctggacatgtccgagttcctcatcaaccccaacgctgggccctgtcgctatgac
ctcatcgccgtctccaaccactacggcgggatggggggaggccactatactgcttatgcg
aagaacaaggacgacgggaagtggtactactttgatgacagcagcgtgtccccggccagc
gaagatcaaatagtgtcaaaagccggctacgtgctgttctaccagcggcaggacacagtg
aagggaactggctactttgctcttgaccgagaggaggaagaagaggaggaggaggaagag
gaagaagaggaggaagaggacacggaaggcattgtgagagcagagagtgccgccgctcaa
ggcgacgaggaggacctcaacgaaaacaggtgccggaagaacgacaacgagcaggaagga
gaggaggaagaggcgcccgaccgagacgtggccatgaaaaccaactga

DBGET integrated database retrieval system