KEGG   Takifugu rubripes (torafugu): 101077812Help
Entry
101077812         CDS       T02386                                 

Definition
STAM-binding protein-like A-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tru04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21
AA seq 428 aa AA seqDB search
MADHNDVTMPPEERVRALTKKGSSVDVNDDVPPRRYFRSGMEMIRMASIYTEEGNIEHAF
LLYNKYITLFIEKLPKHPDYKTANIPEKKETLKKLKDVAFPQAEILKKALLKRFDQEYAQ
YLSKKKAEEEVLAREQSRQRALDVERERVAEMQRRQREQEQFSAFEEMIRRQELEKERQR
VLLEFPKPATPSPDAPLIPGIQPPSLVSPSAPQGPGDLSTNHQYNRPPQSAGPPNFDRSL
KPGSLFSPGNNNTMVDALRQLSVPSELCRSFLRLAEANTSRAVETCGILCGKLTRNAFTV
THVIVPKQCGGPDYCDTENEEELFLIQDQYDLITLGWIHTHPTQTAFLSSVDLHTHCSYQ
IMLPEAIAIVCSPKFNEIGYFKLTDRGTKEISTCKQKGFHPHSKDPPLFTHAGHVSITEG
TVAVVDLR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccacaatgacgtcacaatgccgccagaggagagagtccgtgcgctgaccaag
aaaggaagctctgtggatgtcaatgatgatgtgcccccacgccgctacttccgttctggc
atggaaatgatccgtatggccagcatctacacggaggagggcaacatcgagcacgccttt
ttactgtacaacaaatacatcacactttttatagaaaaacttccaaagcatcctgactac
aagacggctaacattcctgaaaagaaggaaacactaaaaaaactgaaggacgttgccttt
cctcaagcggagatcctaaaaaaagctcttttgaagagatttgatcaagagtatgcacaa
tatctttccaaaaagaaagcagaggaggaggtgttggcacgggagcagtccaggcagcga
gcactggatgtggagcgggagcgcgtggccgagatgcagcggcgtcagcgggagcaggag
cagttcagtgcctttgaggagatgatccgccgtcaggagctggagaaggaacgccagcga
gtactcctggagtttcccaagcctgcgacgccttcccccgacgccccgctcatcccaggc
atacagcccccctcgctcgtctctcccagcgccccacagggcccaggggacctttccacc
aaccaccaatacaatcgccctccccaaagcgctggcccacccaatttcgaccgatcactc
aagcccggttccttattcagcccggggaacaacaatacaatggtggatgcccttcggcag
ctgtccgtgccctctgagctgtgcagaagctttctgaggttggctgaagccaacacaagc
cgggctgtagaaacatgcggcatcttgtgtggcaaactgaccagaaacgcgtttacagtg
acgcacgtcatcgtaccgaagcagtgcggtgggccggattattgtgacaccgaaaatgag
gaagaactcttcctcatacaggaccagtatgatctcatcaccttgggctggatacatact
cacccgacacagacggccttcctgtccagcgttgacctacacacacactgctcctaccag
atcatgctgccagaggctatcgctatcgtctgctcgccaaagttcaacgaaattgggtac
ttcaagttaacagatcggggaacaaaggaaatatccacgtgtaaacagaaaggttttcac
cctcacagcaaagatccacctctctttacgcatgcgggacacgtctccatcaccgaaggc
actgtggcagtggtagacttgcgatga

DBGET integrated database retrieval system