KEGG   Takifugu rubripes (torafugu): 101077914Help
Entry
101077914         CDS       T02386                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tru00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 261 aa AA seqDB search
MHVLLLKEPRDGESGIDPYIKELASHGHTATLIPVLSFAFVSLSTLSDKLFQPEKHGGLI
FTSPRAVEAVKMCLEAEKRVEEWNKCVRDQWNAKSVYVVGKATAALVRSLGLTPLGEDTG
TAEVLSRVIIEREDTNIPPLLFPCGSIKREVLPTALRGSGVPLEMLTVYQTAEHPNLEEN
LRSYFTEQGTPASIAFFSPSGVKFCLETVRRLSGDQLPQIKFAAIGPTTEEAMAAEGLCV
SCAAEKPTAGHLAAAIAKALQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgttactacttaaagagccaagagatggggagtctggaattgatccttacatt
aaggagctggcatcacatggacacacagcaaccctcattcctgtgttatcttttgcgttt
gtctcattaagtacattgtcagataagctgttccaaccagaaaaacatggcggtcttata
tttaccagtccgagagccgtggaggctgtgaagatgtgcttggaagcagagaaaagagtt
gaagaatggaacaaatgtgtaagagaccaatggaacgccaagtccgtctatgtggtcggg
aaggcgacggcggctttagtgcgcagtctgggtctgacccctctaggtgaggacacgggg
acggcggaggtcttatcgcgtgttatcattgaacgagaagacacaaatatcccgccgctg
ttgttcccctgcggttccatcaaaagagaggttctgcctacggcgttaagagggagcgga
gtccccctagagatgctgactgtctatcaaacggctgaacatcccaatctggaggagaat
ctaaggagctatttcacggagcagggaacgccggccagcatcgctttcttcagcccatcg
ggggtgaagttctgcctggagacggtgcgcaggctgtctggcgaccagctgcctcagata
aagtttgcagccattggaccgacgacagaggaggcgatggctgcggagggtctgtgcgtc
agctgcgccgcggaaaagccgacagcgggacacctcgctgcagcgatagctaaagctctc
cagtag

DBGET integrated database retrieval system