KEGG   Takifugu rubripes (torafugu): 101077993Help
Entry
101077993         CDS       T02386                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    101077993
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101077993
   04115 p53 signaling pathway
    101077993
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101077993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 104 aa AA seqDB search
MGDIAKGKKTFVQKCAQCHTVEQGGKHKTGPNLWGLFGRKTGQAEGFSYTDANKSKGITW
NEDTLLEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKSATS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggagacattgcaaagggaaagaaaacttttgtccagaagtgtgcccagtgccacact
gtagagcaggggggcaagcacaagacgggccctaacctctggggactgttcggacgaaaa
accggtcaggcagagggcttctcgtacacagatgccaacaagagtaaaggtattacttgg
aatgaggacaccctgctggaatatctagagaaccccaagaagtatattcctggaaccaaa
atgatcttcgccggcatcaagaagaagggagaacgccaggacctgatcgcctacctgaaa
tcagcaacctcatga

DBGET integrated database retrieval system