KEGG   Takifugu rubripes (torafugu): 101078015Help
Entry
101078015         CDS       T02386                                 

Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101078015
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C86
   101078015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 184 aa AA seqDB search
MSEGEVFHEKQRLELCAIHALNNVLQERVFTKETADDLCKRLAPQCVVNPHRSVLGTGNY
DVNVIIAALQSRDLAAVWWDKRRTVQSLCVSKVQGFILNVPSKVSLGIVSLPLRRRHWLA
VRQVDGQYYNLDSKLKSPVCIGGEAELRTFLSEQLSQDVAEMLLVVGREVEEDMSWLNSD
DAAK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaggagaagtgttccatgagaagcaacggctggagctgtgtgccattcatgcc
ctcaacaacgtgctccaggagcgggtgtttaccaaagagacagccgacgacctctgcaaa
cggctggctccacagtgtgtggtgaacccccaccgctcggtgttggggacaggaaactac
gacgtcaacgtcatcatagcggcgctccagagcagagatctggcagcggtgtggtgggac
aagcgcaggacggtccagagcctttgcgtgtcaaaggtccagggttttattctcaacgtg
ccctcgaaagtatctctggggatcgtgtcgctcccgctccgacggcggcactggctggcg
gtgcggcaggtcgacggccagtactacaacctggactccaagctgaaaagccccgtttgt
atcggaggagaggcagaactacgcacgttcctcagcgagcagctctctcaggacgtggca
gagatgctcctggtggtcgggcgggaggtggaggaggacatgtcctggttgaactccgac
gacgccgcgaaatga

DBGET integrated database retrieval system