KEGG   Takifugu rubripes (torafugu): 101078102Help
Entry
101078102         CDS       T02386                                 

Definition
glutamate receptor 4-like
Orthology
K05200  
glutamate receptor 4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101078102
Ion channels [BR:tru04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   101078102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 905 aa AA seqDB search
MRISSQDWFLLMFSSFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASE
APFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLIT
PSFPTEGESQFTLQLRPSIRGALLSLLDHYDWNKFVFLYDTDRGYAILQAIMERAGQNNW
QVSAICVESFNDASYRRLLDDLDRRQEKKFVIDLEAERLQNMLEQIVSVGKHVKGYHYIM
ANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQRWNKLDQREYPGSDTPPKYTSA
LTYDGVMVMAEAFRNLRRQKVDISRRGNAGDCLANPAAPWNQGIDMERTLKQVRLQGLTG
NVQFDHYGRRVNYTMDVFELKNNGPRRIGYWNDADKLVLIQDSPLLPNDTTGLENRTVVV
TTIMEGPYVMLKKNWEMYEGNDQYEGYCVDLAAEIAKHIGIKYKISIVPDGKYGARDPDT
KIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF
LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGPPSDQPPNEFGIFNS
LWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESA
EDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKS
KGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRSAVNLAVLKLNEQ
GLLDKLKNKWWYDKGECGSGGGGEKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFC
YKSRNEAKKMKLTFTEAMRNKARLSITGSVGENGRVLTPDCPKAVHTGPPLHQSSGLALV
SSELP
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttcttcccaagactggtttctgctcatgttctccagcttctggggactggcg
atgggagcgttccccagcagcgtccaaatcggtggtttgttcatcagaaacacagatcag
gagtacactgctttccgtctcgccatcttcctgcacaacaccagcccaaacgcctctgaa
gccccattcaacctggtgcctcacgtggacaacatcgagacagccaacagcttcgctgtc
accaacgccttttgttcccagtactcccgcggcgtgttcgccatctttggcctgtacgac
aaacgctcggtccacacgttgacgtccttctgcagcgctctgcacatctccctcatcacg
cccagcttccccaccgagggggagagccagttcacgctgcagctgcgaccttcgattcgg
ggagccctgctgtcgctgctcgaccactacgactggaacaagttcgtcttcctgtacgac
accgaccgaggctacgccatcctgcaggccatcatggagcgggcgggacaaaacaactgg
caggtcagcgccatctgtgtggagagcttcaatgacgccagctaccggcggctgctggac
gatctggaccggaggcaggagaagaagtttgtcatcgacctggaggcggagcgactgcag
aacatgttggaacagatcgtcagcgttgggaaacatgtcaaaggttaccattacatcatg
gccaacctgggctttaaggacatcaacctcgagcgcttcatgcacggtggtgccaacgtc
accgggttccagctggtggacttcagcaaccccatggtcatcaagttgatgcaacgctgg
aataaactggaccagagggagtaccccggctctgacaccccgcccaagtacacatcagcg
ctgacgtacgatggcgtgatggtgatggccgaggccttcaggaacctgcggcgtcagaaa
gtggacatctccagacgaggaaacgctggagactgcctcgccaaccccgcagcgccgtgg
aaccagggcatcgatatggagcgcaccctcaaacaggttcggctgcagggattaacaggt
aacgtccagtttgaccattatggccgcagggtcaactacaccatggacgtatttgagctg
aagaacaacggacccagacggatcggctactggaatgacgcagacaagctagtgctaatc
caggactcgccgctgcttcccaacgacaccaccggcttggaaaatcgcactgttgtggtt
accaccatcatggagggtccttacgtgatgctgaagaaaaactgggagatgtatgagggc
aacgaccagtacgagggctactgcgtggacctcgctgcggaaatcgccaaacacattggc
atcaagtacaaaatatccatcgttccggatgggaagtatggcgccagggacccagacacc
aagatctggaatgggatggttggggagctggtgtacgggaaagcggaaatcgctgtggcc
cctttgaccatcacgttagtccgggaggaggtcattgacttctccaagcccttcatgtca
ctgggcatttccatcatgatcaagaaaccccagaagtccaaacctggtgtgttctccttc
ctggacccattggcctatgagatctggatgtgcatcgtgttcgcctacattggcgtgagc
gtggtgctcttcctggtcagccgcttcagcccgtacgagtggcacaccgaggagcccgaa
gagggcaccgacggtccgcccagcgaccagccccctaacgagttcggcatcttcaactcg
ctctggttctccctgggtgccttcatgcagcagggctgcgatatttctccgcgatctctg
tctggtcgaattgtgggaggagtttggtggttcttcaccctcatcatcatctcatcctac
acggccaacttggcagctttcctcaccgtggagaggatggtttcacccatcgaaagcgcc
gaagatctggccaagcagactgatatcgcctacggaactttggactctggctccaccaaa
gagttcttcaggcggtctaagatcgccgtctacgagaagatgtggggctacatgaagtct
gccgagcccacagtcttcaccaagaccaccgctgaaggtgtggcgcgagtccgtaagtcc
aaagggaaatacgccttcctgttggagtccaccatgaacgagtacacggagcagcggaag
ccatgtgacaccatgaaagtgggcgggaacctggactctaaaggctacggcgtagctaca
cccaagggttcacagttaagaagtgcagtaaacctggctgtgttaaagctcaatgagcaa
ggcctgttggacaaattgaaaaacaagtggtggtacgacaaaggagaatgtggcagcgga
ggcggtggcgagaaggacaagtcatcacaggcccttagcctcagcaacgtggcgggggtc
ttctacatcctggttgggggcctgggcctggctatgctggtggccctcattgaattctgc
tacaagtcacgcaacgaggccaagaaaatgaagctcaccttcaccgaagccatgaggaac
aaagcccgtctgtccatcacaggcagcgttggtgaaaacgggcgggttctaacacccgac
tgtcccaaggctgtccacactgggcctcccctccaccagagttctggcctagctctggtc
tcctctgagctcccctga

DBGET integrated database retrieval system