KEGG   Takifugu rubripes (torafugu): 101078171Help
Entry
101078171         CDS       T02386                                 

Definition
protein unc-13 homolog C-like
Orthology
K15293  
protein unc-13
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 2565 aa AA seqDB search
MVSTLIKTISSYIHKICKGMFTKKLATPIKKKERSENKEPKLTTDLQAQNLTLSTTLKTT
VKKISKCSSTRNISLEDEDGKKDSSSLSPTFSYRVAIANGLPKSSPFLNNNNESIFPEVL
SIDSSYSDSLSDTKPVRRLDEHKSYTMPVRRNRKSLISLAPSDGSSEGERVERSSLHTLR
LGALRKLRKWKKSQECVSSDSEVSNWRKTLGIRSKSLDRAGRHQKSSTLEPGSSSTGCIS
QTQDVMEMIFKELQGISQIETELSELRGHVNALKSSIDEISSSVEVVQSEIEQLRSGFVQ
SRRETRDIHDYIKQISHQANNSTLRFLNVPEERSEKTETLIYKILKEKLGFIDAHKTIKI
ELAHRLGQQRECSNAKPRPIIVIFAMPQDRDVVLKKCYKLKGTGITVLTDSLTHDGKERK
DKTMSSSQTYESMDIKISGKDKTMESDDWDSMDSDKELDELSRNKYGMVVSKPVQKSKSE
KRRSHERRSGEDASYSGGVHYADDSYYDPEKQGKSYYTDITSGWLSQSDYSTPKLSRSES
DCSKLCQSYSEDFSESPYFTRANGCSLLSSSDQELWQRKQEDMGSSWYANPSHPLDHSNH
AYEHNEVETTETIDSGVSNGLVCMSADRSHYSGSQLSLQGDISPWKDWHHLEQGADSGLE
ASIEVSSPFDPSTIPGFPENITKCQEVDLQFEGDEEFMMLDRESPLPAITTHIIPPITER
EFPKTSTRQSKEGCKVTTKESSKAAKDTSKVVAKTTSKVTHKQTKLAHKEETTKTLPKDS
PNVSSNISSKTAPKVAPKDIQKSAAKESSQAVPKDIPKRVSKDVTKPAVKEVTKATSKAT
SNESVKITPKVTQKDSSTITSKESPKESPRESPKVTPFESPVSTPKESPKDSSKVFAKEP
PQALSQESTKSAPKEVTKEAAKVAPKDAPKSVPKDVPKTLAKETSKAASSETSQTLPKEA
SKTGPKVTQKETPKAPPTNAVKEANKVPPKEVPKEAKTVAKEKFPELDVNHSFIQTQNKS
SSMYRSQSEIRTEKVEEVPKSWSSRLSIDLSEKSFGFGFGSTLQRAKSALEVVWKSGGQG
TPAPPPEEPSNSSSSFMGRFRTLSTSNASTFCTTDSDVGAEPVFCKAEEEKRGNEEEASE
QVDSETHYVEVMEQVLANLENRTNVNETEETIEQGQESETSQDYDVSDDIEASQDNEDSQ
DFPDTDVTEDQGPSKEPHVMEYDCSMDEHYDGEYSEDYETQVAEDTAEYDAMVEYVDVED
PDDNDMTEEMEEGDEELEGVEEITEESIGVAEKLEQGQEDENKNVPEEKPTEAPPKKRVR
PTFKEAALRAYRKQMAELEQQILAGASQYFGSQIARLADWRVSTCSLLKQMHGCMYEPVT
GSILYGIDSMPDLRRKRTVPLVRDLALTLTARKAGISFALVNRSTLNNEDLKLHVFKKTL
QALIYPISSTTPHNFEVWTATAPTYCHECEGLLWGIARQGMRCSECGVKCHEKCQDLLNA
DCLQRAVEKSSKHGAEDKTQNIIMAMKERMKIREKNSPEVFEVIQEMFHVSKEDFNSHLK
TAKQAVLDGTSKWSAKISITVMSAQGLQAKDKTGSSDPYVTVQVGKTKRRTKTIFGNLNP
VWDEKFYFECHNATDRIKVRVWDEDDDIKSRVKQHFKRESDDFLGQTIIEVRMLSGEMDV
WYNLDKRTDKSAVSGAIRLKISVEMKGEENVVPPHGQYTCLHENLFHCLTEVKNNGVVKI
PRVKGDEAWKVYFDDVSQEIVDEFAMRYGVESIYQAMTHFSCLSAKYMCPGVPAVMSNLL
ANINAYFAHTTTTTTTTASASDRFAASNFGREKFVKLLDQLHNSLRIDLSKYRDNFPAGN
PERLQDLKSTVDLLTSIAFFRMKVQELQSPPKASMVVKDCVKACSDSTYKYIFDNCHELY
NQLLDQSRKQDIPREEQGPSIKNLDFWPKLITLMVSIIDEDRTAYTPVINQFPQELNVGK
ISAEIMWNLFALDMKYAMEEHEKHRLCKSTEYMNLHFKVKWFHNEYVRDLPAFKGVSPEY
SLWFEPFVIQWLDENEDVAMDFLNGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFE
IIKKLECPNPQALAHFMCRFAKTINKVLLQYAAIISKDFPSYLSKENVPCIILNNIQQLR
VQLEKMFESMGGKQLDAEASDLLKELQNKLNTVLDELSGVFGSSFKPVIEDCVKQMNQEL
VQMKGSAKGSNAAMDAETVLRPLMDLLDKNLMLFAKICEKTVLKRVLKELWKIVLNSIER
TIVLPPLNDQSVTQMIFNAAKDLGQLSKLKEHVIREEARSLTPRQCAAMDLVLPTIKQYF
HAGGNGLKKTFLEKSPDMKSLKYALSLYTQPTDALVKKYICTQTSQGQSANGSVGEVSMQ
VNLISHPGTGEHKVSVKVVAVNNLIWQTNAMFRPFVEVNALGPHLTDKKRKFSTKTKNNN
WSPKYNETFQYVLSNEHGPEAYELHVSVKDYCFAREDRIIGMTVIQLRELADNGSCSGCY
PLMKSISMDDTGLTIMRILSQRTNDEVAKEFVRLKMDTRSAEEVS
NT seq 7698 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaacccttataaagactatatcatcatacatacataagatttgcaaaggaatg
tttacaaagaaattggcaaccccaataaagaagaaagagagaagtgaaaataaagaacca
aaattgaccactgatttgcaagcacaaaatctaactctctcaacaacactgaagactaca
gttaaaaagatttccaaatgctcttcgacacgtaacatatcgcttgaagacgaagacgga
aagaaagactcctcgtccctgtctcccactttcagttatcgtgtggctattgcaaatgga
ctcccgaaaagctctccttttctgaataataataatgaaagtatatttcctgaggttctt
tcaattgatagtagttactctgactctttgagtgacacgaaacccgtgaggagactggat
gagcataaatcttacactatgccagtaagacgaaacaggaagagccttatcagtttggct
ccttctgatggcagctccgagggtgaacgagtggagcgttcaagtctacacacacttcgg
ttgggtgcactgcgcaaattaagaaaatggaaaaagagtcaggaatgtgtctcctcagac
tcagaggtgagcaactggaggaaaactttgggcatccggagcaagtccttggaccgtgcc
ggacggcaccaaaaaagctccacgctagagcccggctcatcctccacgggctgcatcagt
cagacacaggatgtgatggagatgatctttaaggagctacaggggatcagtcagatagaa
acagaactgtctgaacttcgtggccatgtcaatgctctaaaaagctcaattgatgaaatc
tctagcagtgtggaggttgttcagagtgaaattgagcagcttcgctcaggatttgtccag
tctagaagggaaacgcgtgatattcatgactacataaaacaaatcagccaccaggccaat
aactccaccttgagattcctcaatgttcctgaagagaggtcagagaaaacagaaaccctc
atatataaaatactaaaggaaaaactgggttttattgatgcccataaaacaattaaaatt
gagctagctcataggttaggccaacagagagaatgttctaatgcaaaacctcgtcctatc
attgttatttttgctatgccacaagatagagatgttgtcttaaaaaaatgctataaatta
aaggggactggcattacagtcttaactgatagcttaactcatgatggaaaagagagaaaa
gataaaactatgtcttcatctcagacttatgaaagcatggatataaagatttcaggaaag
gacaaaacaatggagagtgatgactgggactctatggacagtgataaagaattagatgaa
ttaagcaggaataaatatggaatggtggtatcaaaacctgttcaaaagagcaaatctgag
aagagacgatcccatgagcgccggtctggagaggatgccagctactcgggtggagttcac
tatgcagatgattcttattatgatccagaaaagcaaggaaaatcctattacactgatata
acttctgggtggctttcccagagtgactattccacccctaaacttagccgttctgaatct
gattgctcaaaactttgccaatcatattcagaagacttttcagagagcccgtactttaca
cgggctaatggctgctcattactgtcatcctcagatcaggagctttggcagagaaaacaa
gaagacatgggttcctcttggtatgcaaaccctagtcaccccctcgatcatagtaatcat
gcctatgaacacaacgaggttgaaacaactgaaacaattgacagcggagtcagcaatggg
cttgtctgcatgtctgcggacagaagccactacagtggctcccagctttccttgcaaggt
gacatatcaccatggaaagactggcatcatctagagcagggtgctgattcaggcttggaa
gcatccatagaggtcagcagtccttttgacccatcgactattccaggatttccagaaaac
atcacaaaatgtcaggaggttgatttacagtttgaaggagatgaggaattcatgatgctt
gacagagaatctcccctaccagctataacaacccacattattccaccaatcacagaacgt
gagttcccaaagacatctactcggcaatctaaagagggatgtaaagttaccactaaagaa
agtagcaaggcagcaaaagatacttctaaagttgtagctaaaacaacatctaaagttaca
cataaacaaactaaactggcccataaagaggaaaccactaaaacattgccaaaggacagc
ccaaatgtgtcgagtaacatttcatcaaaaactgcccctaaagtggcaccaaaagatatt
cagaagtcagcagctaaagaatcctctcaggctgtcccaaaagacattcctaaacgtgta
tccaaagatgtaacaaagcctgcagtaaaagaagtgactaaagctacaagtaaggcaact
tcaaatgaatcagtgaaaattactcccaaagtgactcaaaaagatagttcaacaataacc
tctaaagaaagtccaaaagagtcacctcgagagagccctaaggtaacaccatttgaaagt
cctgtgtccacccctaaagagtccccaaaagattcctctaaagtctttgctaaagagcct
ccacaagctctatctcaagaaagtacaaaatctgctcctaaagaggttaccaaagaggct
gcaaaagtggctccaaaagatgcacctaaatcagtacctaaagatgtacctaaaacatta
gcaaaagaaaccagtaaagcagcctctagtgaaacttcacagaccctacctaaagaagct
tcaaagactggtccaaaggtgactcaaaaagagacccctaaagctcctcccactaatgcc
gttaaagaggcaaataaagtgccacccaaagaggtccctaaagaagctaaaacagtagca
aaagaaaagttccctgaactggatgtgaatcacagttttattcagacacagaataaatcc
tcatctatgtaccgtagtcagagtgagattcgaactgagaaggttgaggaagttcctaaa
tcctggagcagtagactcagcatagatctcagtgagaagtcttttggttttggctttggt
tctacactacaaagagctaaatctgctttggaagtcgtctggaagtctggtggtcaggga
actccagcacctcctccagaggagcccagcaattcttcctcttcattcatgggccgtttc
cgcaccctctcaacttctaatgctagtaccttttgtactacagactcagatgtgggtgca
gaacctgtcttctgcaaggcagaggaagaaaaaagaggcaatgaggaagaggccagtgaa
caagtggacagtgagacacactatgttgaagttatggagcaggtattggcaaacttggaa
aacagaactaatgttaatgagacagaggagacaattgagcaaggacaggaaagtgagact
tctcaggactatgatgtctctgatgacattgaggcctctcaagataatgaagattctcag
gattttccagatactgatgtcacagaggaccaaggaccaagtaaagagccacatgttatg
gagtatgactgcagtatggatgaacattatgatggagaatacagtgaggactatgaaact
caagtcgctgaagacacagctgagtatgatgcaatggtggagtatgtagatgtagaggac
ccagatgacaatgacatgacagaggagatggaggagggtgatgaggagttagagggggta
gaggagataacagaagaatccatcggggtggctgaaaaattggagcaggggcaggaggac
gaaaacaaaaatgttccagaggagaagcccacagaggccccgccgaaaaaacgtgttaga
cccacattcaaggaagcagccttacgcgcctacaggaagcaaatggctgaacttgagcaa
cagatcctggctggagcctcgcagtattttggatcccaaattgctcggcttgcagactgg
agggtgagtacctgctctcttctcaagcagatgcacggatgcatgtatgaaccagtcact
ggcagtattctttacggcattgacagcatgccagatttacgccgtaagaggacagtgcct
cttgtccgggacctggctttgaccctcactgctcgaaaggcaggcatctcatttgctctg
gtgaaccgatcaacgctgaataatgaggacctgaaattacacgtcttcaagaagactctg
caggccttgatttaccctatttcatccacgacaccccataactttgaggtgtggacggcg
accgcgccgacctactgccatgagtgcgaggggctgctatggggcatcgcacgccagggc
atgcgctgctcagagtgtggtgtcaaatgccacgagaagtgccaggacctcctcaatgca
gactgtttacaaagggccgtggagaagagctccaagcacggggcagaagacaagacccag
aatatcatcatggctatgaaggaacgcatgaaaatacgggagaagaacagcccagaagtg
ttcgaggtgatccaggagatgtttcatgtctccaaagaggactttaacagtcacctgaag
acagccaagcaggctgtgctcgacgggacctccaagtggtctgcaaaaatcagcatcaca
gttatgagtgctcagggactacaagccaaggacaaaactggttccagcgatccctacgtc
acggtccaggtgggaaagaccaaacggaggaccaaaaccatttttggcaacctcaacccg
gtgtgggatgagaaattctacttcgaatgtcacaacgccacagatcgaatcaaggtgcgc
gtgtgggacgaggacgatgacatcaagtcgcgagtgaagcagcacttcaagcgcgagtcg
gatgacttcctgggccaaaccatcatcgaggtccgtatgctgagcggagaaatggatgtc
tggtacaatctagataaacggactgacaagtctgcagtatctggagccatcagactcaag
attagcgtggagatgaaaggggaggagaatgtggttccacctcatggccagtatacctgt
ttacatgagaacctgttccactgcctgaccgaggtgaagaacaacggagtggtgaagatt
cctcgggtgaaaggggacgaagcgtggaaggtctactttgatgacgtatctcaggagata
gtggatgagttcgccatgagatacggagtggagtccatctatcaggctatgacgcatttc
tcctgtctgtctgctaaatacatgtgtcctggcgtgccagccgtgatgagcaacctgctg
gccaacatcaacgcttacttcgcacacaccaccacgactaccacaaccacggcgtccgcc
tctgaccgattcgctgcgtctaactttgggagggagaagttcgtgaaactgctcgaccag
ctgcacaactcgctgaggattgacctctccaaatatcgggataatttccccgcaggtaat
ccagaacgtctccaagatctcaagtccactgttgacctgctgaccagcattgctttcttc
agaatgaaggtccaagagctccagagtccaccaaaggccagcatggtagtgaaggactgc
gtcaaagcgtgcagcgactccacgtacaaatacatctttgacaactgccacgagctgtac
aaccaactcctcgaccagagccggaaacaggacattccccgtgaggagcagggtccgtcg
ataaagaacctggacttctggccaaaactcatcaccctcatggtgtccataatcgatgag
gaccgcacggcctatacgccagtcatcaaccagttcccacaggagctgaacgtgggcaag
atcagcgctgagatcatgtggaacctgttcgccctagacatgaagtatgcaatggaagag
cacgagaagcaccgactatgcaaaagcaccgagtacatgaatcttcacttcaaagtcaaa
tggttccataatgagtacgtccgcgacctgccggcctttaagggggtttctcccgagtat
tctctatggttcgagccatttgtcatccagtggctcgatgagaatgaagacgtcgccatg
gatttcctcaatggagcgctggaacgggacaagaaggatggattccagcagacttcggag
cacgctctcttttcctgctcggtggtggacgtgtttactcagctgaaccagagtttcgag
atcatcaagaagctggagtgtccaaacccgcaggctctggctcacttcatgtgccgcttc
gcaaagaccatcaacaaagttcttctgcagtatgctgcaatcatatccaaggactttcct
tcgtatctgagcaaggagaatgtgccctgcattatcctcaacaacatccagcagctccgt
gtgcagctggagaaaatgtttgagtccatgggggggaaacagctggatgcagaggccagt
gatctgctgaaggagctgcagaataaactcaacactgtgctggatgaactcagtggagtg
tttggctccagcttcaaacccgtcatcgaggactgtgtgaagcagatgaaccaggagctg
gtacagatgaaaggatcagccaaagggagcaacgctgcgatggatgcagaaacggtcctc
cgtcctctgatggacctgctggataaaaatttgatgctcttcgccaagatttgcgagaag
acggtgctgaagcgggttctgaaagagctgtggaagatcgtgctgaactccatcgagagg
acaatagtcctgcctcctctaaatgaccaaagtgtgacacagatgatcttcaatgctgca
aaagatttgggacagctgtccaagctcaaggagcacgttatccgagaggaagccaggagc
ctgacaccgcgtcagtgtgcagctatggaccttgtacttcccaccatcaagcaatatttc
cacgctggaggaaatgggctgaagaaaaccttcctcgagaagagcccggatatgaaatct
ctcaaatacgctctcagcctttatactcaacctacagatgccttggtcaagaaatatata
tgcacccaaacctctcaaggtcagtcagccaatggatcagtgggggaggtgtcgatgcaa
gtgaatctcatctctcaccctggcactggagagcacaaagtcagcgtgaaagtggtcgca
gtaaataacctcatctggcaaaccaacgccatgttccgaccgtttgtagaggtcaatgcc
ctgggcccccacctgacggacaagaagcgcaaatttagcaccaagaccaagaataacaat
tggtcaccaaagtacaatgaaacattccaatatgttctaagtaacgaacatggtccggag
gcctacgagctgcacgtctcagtgaaggactactgcttcgcccgcgaggaccgcatcatt
ggcatgacggttatccagctccgagagctagcggacaatggcagctgttctggctgctac
cccttaatgaagagcatctccatggatgataccggcctgaccatcatgaggatactctct
caaaggaccaacgatgaggtggccaaagagtttgtccgtctcaagatggacacgcggtcg
gccgaggaagtgtcataa

DBGET integrated database retrieval system