KEGG   Takifugu rubripes (torafugu): 101078271Help
Entry
101078271         CDS       T02386                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101078271
   01210 2-Oxocarboxylic acid metabolism
    101078271
   01230 Biosynthesis of amino acids
    101078271
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101078271
Enzymes [BR:tru01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101078271
Amino acid related enzymes [BR:tru01007]
 Aminotransferase (transaminase)
  Class I
   101078271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22
AA seq 555 aa AA seqDB search
MAASRMQLLSPRNLSFLGRGRTELFAVSGAPKRAGDGPRGRALNSSPVSSRTISSVSETR
RGLPREKMTENGVSSRAKVLTIDTMNPTVKKVEYAVRGPIVQRAVELERELSQGVKKPFA
EVIKANIGDAHAMGQQPITFFRQVLALCSYPELLNDSTFPEDAKSRARRILQSCGGNSLG
SYSASQGIESVRQDVARYIERRDGGVPCAPDNIYLTTGASDGIVTMLKLLVCGEGATRTG
VMISIPQYPLYSAALAELGAVQVNYYLNEEKCWSLDISELQRSVDEARTHCNPRALCIIN
PGNPTGQVQSRQCIEDVIRFAAKERLFLMADEVYQDNVYADGCQFHSFKKVLFEMGPEYS
STVELASFHSTSKCYMGECGFRGGYMEIINMDNEVKAQLTKLVSVRLCPPVPGQALMDLV
VNPPQPGEPSYDNFIKERTATLSVLAEKAKLTEQVLNTVEGIRCNPVQGAMYSFPRISIP
EKAVKEATANGQQPDMFYCMRLLEETGICLVPGSGFGQKDGTYHFRMTILPPTDKLKILL
DKVKEFHHKFTQKYS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcacggatgcagcttctctcacccagaaacctcagctttttaggccgcggg
cgaaccgagctgttcgccgtcagcggcgcaccgaagcgggccggtgatggtccgcggggc
cgcgcactgaactcctctcctgtgtcctccagaaccatttcctccgtgagtgagaccagg
cgtgggcttcccagagagaaaatgaccgagaatggagtctcgtccagggccaaggtgctg
accatagacaccatgaaccccacggtgaagaaggtggagtacgccgtgcgggggcctatc
gtgcagcgggctgtggagctggagcgggagctctctcagggagtgaaaaagccatttgct
gaagtcatcaaggccaacattggggatgcacacgccatgggacagcagccaatcacgttc
ttcagacaggtcctggcactctgttcgtaccctgagctgctaaatgacagcacattccca
gaggacgctaaaagtagagcgcgccgcattcttcagtcctgtggagggaacagtttgggc
tcctacagcgccagccagggcatcgaatctgtgcgtcaggatgtggcacggtacattgag
cgaagggatggcggcgtgccttgtgcccccgacaacatttacctcaccacgggagccagc
gacggcattgtgaccatgctaaaactgcttgtgtgtggcgagggcgcgacccgcacaggc
gtcatgatctccattccccagtatccgctctactcggctgctctggcagaactgggagcg
gtgcaggtcaactattacctgaatgaagagaagtgctggagtctggacatcagcgagctg
cagcgctctgtggacgaggcccggacgcactgcaaccccagggccctgtgcatcatcaac
cctggaaaccccactggtcaggtccagagcagacagtgcattgaggatgtcatccgattt
gcagccaaggagcgccttttcctcatggccgacgaggtataccaggataacgtgtatgcc
gacggttgtcagttccactcctttaagaaagtcttgtttgaaatgggcccggagtactcc
agcacggtggagttggcctcgttccattctacctccaagtgttacatgggggagtgtggc
ttccgtggcggctacatggagatcatcaacatggataatgaggtgaaggctcagctgacc
aagctggtgtccgtccgtctgtgtccccccgttccaggacaggctctgatggacctggtg
gtcaaccctcctcagcctggggaaccctcatatgacaactttattaaggagcgcacagct
accttgagtgtcttggcagagaaggccaaactcacagagcaggttctcaataccgtggaa
ggcatccgctgcaatcccgtgcaaggggccatgtactccttccctcgcataagcattcca
gaaaaggccgtcaaagaggccacggccaacggccagcagccggatatgttttactgtatg
aggttgctggaggagacggggatctgcctcgtacctggaagtggcttcggtcagaaggat
ggaacctaccatttcagaatgaccatcctgccaccgacagacaagctgaagatcctgctc
gacaaagtgaaagaattccatcacaaattcacacagaagtattcataa

DBGET integrated database retrieval system