KEGG   Takifugu rubripes (torafugu): 101078373Help
Entry
101078373         CDS       T02386                                 

Gene name
crebbp
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101078373 (crebbp)
   04330 Notch signaling pathway
    101078373 (crebbp)
   04350 TGF-beta signaling pathway
    101078373 (crebbp)
   04630 Jak-STAT signaling pathway
    101078373 (crebbp)
   04068 FoxO signaling pathway
    101078373 (crebbp)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101078373 (crebbp)
  Cellular commiunity
   04520 Adherens junction
    101078373 (crebbp)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101078373 (crebbp)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101078373 (crebbp)
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101078373 (crebbp)
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101078373 (crebbp)
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101078373 (crebbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 2449 aa AA seqDB search
MADNLLDVVGPPTAKRPKLNSPLSGSDGTDLVSLLDLENDLPDELIPNGDLGLGLSSNGG
PGGGGTGLHAVVPDAAAKHKQLSELLRSGSSSLSGSGTLQGGMVGSQLGAVLGKGPLGQG
STNHQAQKGGVAAGQGNGSPGMCFNQTMLNSGQGHGVMGQAGQVMNGTLGPAGRGRPGMQ
YQGQGMPSSQGAGVGGSVLAETLAQGGAQLGNHNVLNAQQAGTMNKMGMSGAPFGQQYGQ
AGVQQMGTAGVNGQQLQNKTALSNNLPQFSNELKGAGSVPNMPQLQQQVGSVGMVPGVGG
VSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQ
AGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNATDKRNQQSMLGSPGAGLQNPIST
VGPGQPTPTAISSAATHIDPSSMQRAYAALGLPYGNQSPAQVQGLSQQKLQGTQHQQLQN
MNPLGTNQINPMAGSMGVPSSDQTGMHSDGTLPTTVSNQLMPDGSIGGGVGNLPAAAPLS
ATGVRKAWHEHVTQDLRTHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESA
NSRDEYYHLLAEKIYKIQKELEEKRRSRLQKQPGMMGNAGPQQPVMTQSNAMGPGQTIRP
PNGPVSMPNMPNQILSRMQVPQGINQFNPIAMQNAQMSQAPMGARAPSPMNHPQQINMNS
VSTMGMSPSRMPQTQGMMGSHANNMVPQPANQGQFLSQGQFTAPAGGAMNVGLGQPKTQP
AVSQPQNANIPLNALGSLGSQLPCGPASQSPLRATPPPNTSASLQTQQQQQQQQQQHHHH
HHHLVSAQQQVPMQPPTPVSASGPSTTPTHIPSSLPSLPQAMSTTPEPSLPLTPLQPQTE
PSSQMQQPSSVQAQHPSTPSSQAAASIDNRVPTPASVAELSSQQALPDMNSTESTFQIKK
EEDDNTVGKKQVDIKMEDDEIKPPLAKKEEPVIAEPKQEMTGNDSAENKTEIKTEPKEED
DNGASSTSAASATQNRKKVFKPEELRQALMPTLEALYRQDPESLPFRQPVDPMLLGIPDY
FDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCTKLAEVF
EAEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTISRDGTYYSYQNRYHFCEKCFNEIQ
GNSVTLGEDPAQPQTMISKEQFEKKKNDTLDAEPFVECKDCGRKMHQICVLHYDVIWPSG
FICDNCLKKSGKTKKDNKFSARRLQTTKLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASS
DKTVEIKPGMKSRFVDTGEMVETFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPN
TRRVYISYLDSVHFFKPRLLRTAVYHEILIGYLEYVRKLGYVTGHIWACPPGEGDDYIFH
CHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSANELPYFEGDFW
PNVLEESIKELEQEEEERKKEENTASTETTEGAHPDSKNAKKKNNKKTNKNKSSISRANK
KKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIIDPDPMLTCDLMDGRD
AFLTLARDKHWEFSSLRRCQWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCED
YDLCINCYNAKGHEHQMVKWGLGLDDDSSGQGGEASKSPQESRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKNCQENKCPVPFCLN
IKHKLHQQQLQHRLQQAQMMRRRMATMAGRGMPMPSPPTSAAPDTPNSAQQPNTPQTPQP
MPNQPQQHQPPNSANIAQGFANSHGSQPPTPVPQGKLGPQSSPLHQQQSPLPNMPHQQQP
QPPSQQQQQQQQQQQQQQQQQQQQQQQPLLAALKVARQIEMAAKVKQQQQNYAMNGIPMN
HPRMMGPMQGQMQMMQGPRGPQVMQAMQQGQWAPGMQNPQGHQQQVTSQQGPMVAPQQAQ
GTPMTQQGQLMQRPMMPQQHGLQMPGVIPPQGPSQQGMTPQQHNMPRGIPGNIAPSALQE
LLRTLKSPNSPQQQHQVLTILKSNPHLMAAFIKQRTAKYQANQQQQQVQPQQNPQAMMGP
QAGMQSMAGIANQVPRPGMAPQQQSQQAGPQGMPAMGPQGQMMNTAQNGNPQLYRRQQQL
LRMQQMQQQGAMPQGHGQFPQQQPGPASYSQLRMQQQMTMQGGGGAMGQLPPTSQMGQPG
MGMDGAQNLLQQRMLQQQQQQQQQQQQQLLKQQMGSPAQTNSMSPQPHMLQGQGQGAAHL
PGQTMANQVRSPAPVQSPRPPSQQPPHSSPSPRIQPQPSPQHSALHSGSPHPSLGGPMSG
SMEQGHMGTPEQSAMLPQLNTPNRGGLNNDTNMVGDTTGDTLERFVEQL
NT seq 7350 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatcttctggatgtggtcggaccccccactgcaaagcgtcccaagctgaat
tcacctctctcaggatcagatgggacagacctcgtatctctgcttgacctggaaaatgac
cttccagatgagctcatcccaaatggagacttaggattgggactgtcctctaatggtggt
ccaggtggaggaggcactggcctccatgctgttgtccctgatgcagctgccaaacacaag
cagttgtctgaacttcttcggtcaggaagctcttctctttcgggatcgggcaccctacag
ggaggcatggtgggaagtcagcttggtgctgtgcttggcaaaggcccacttggacagggc
tctaccaaccaccaggctcagaaaggtggggtagctgctggacagggcaatggaagcccg
ggcatgtgcttcaaccagactatgctgaacagtggacagggtcatggggtgatgggtcaa
gctggacaagtcatgaatgggaccctgggaccagcaggtcgaggcagacctggcatgcag
taccagggtcaaggcatgccgtcttcacagggagctggagttgggggcagcgtgctggct
gaaacactcgcacagggtggagcgcagctcggtaaccacaacgtgctgaatgctcagcaa
gctggtaccatgaataagatggggatgtcgggggctccatttggccagcagtatggccag
gctggggtccagcagatggggacagcgggtgttaatggccaacaactacagaacaagaca
gcactttccaacaatcttcctcaattctccaatgagctaaagggagctgggagtgtgcca
aacatgccccagctgcagcaacaggtaggctcagtgggaatggtacctggggttggtggt
gtgtcggcaggtccaacagctgaccctgagaagcgcaaactcattcagcagcagctggtc
ctgttgctccatgcacataagtgccaacggcgggaacaggccaacggagaggtgagggcc
tgttcactaccccattgccgtaccatgaaaaacgtcctcaaccacatgacccattgccag
gctggcaagtcctgccaggtggctcattgtgcatcatcccgacaaatcatctctcactgg
aagaactgtacacggcatgactgtccagtatgcctgcctttaaagaatgctactgacaag
aggaaccagcaatccatgctaggttctcctggggctggcctgcagaatccaattagcaca
gtaggacccggtcagcctactcccacagccattagcagtgcagccacacacattgaccca
agctccatgcagagggcctacgctgcccttggtctgccatatgggaatcagtcccctgct
caggtccagggtctcagtcaacagaaactccagggcactcaacatcagcagctgcaaaat
atgaacccactaggcactaatcagataaacccaatggcaggaagcatgggtgtcccctct
tcggaccagactggcatgcactcggatggcacgctaccaactacagtcagcaaccagctg
atgccagatgggtcaataggaggtggtgtgggaaacttgcctgctgctgcccccctttct
gctacaggggtaaggaaggcctggcatgagcatgtcactcaggacctgcgcacccacctg
gtgcacaaacttgtacaagccatattccccacaccagaccctgcagcgctgaaggacaga
cgaatggagaacctggtggcatatgcccggaaagttgagggtgacatgtatgaatctgct
aatagcagggatgagtattaccatttactggcagagaaaatctacaaaattcagaaagaa
ctagaggagaagagacgatcacgactccaaaagcagcctggcatgatgggcaacgctggt
cctcaacagcctgttatgactcagtcaaacgccatgggccccggacaaacaatccgacct
cccaatggtcctgtgtctatgcccaacatgccaaatcagatattgagccgcatgcaggtg
cctcaaggaatcaatcagttcaacccaatagcaatgcagaatgcacagatgtcgcaggca
cccatgggagcacgtgctccatcccctatgaaccatccacaacagatcaacatgaactct
gtctcaacgatgggaatgtcgccctcaaggatgcctcagactcaaggaatgatgggtagt
catgccaataacatggtacctcaaccagcaaaccagggccagtttctgtcacagggccag
ttcacagcacctgcagggggagcaatgaatgtaggattgggccagccaaaaactcagcct
gccgtctcacagcctcaaaatgctaacatccctctgaatgcactgggatcacttggctcc
cagctgccctgtggccctgcatcccagagccctctgcgtgccactccaccacccaatacc
tctgccagcctgcagactcaacaacaacaacagcagcagcagcagcagcaccaccaccac
caccaccaccttgtttctgcacagcagcaggttccaatgcagcctcctacccctgtctct
gcgagtggcccctccaccacacccacacacatacccagtagcctccctagccttccacaa
gccatgagcacaacccctgaaccctccttgccgcttacacccctgcagcctcagacagag
ccttccagccagatgcagcagcccagctcagtgcaagcccagcaccccagcacgccgtca
tcccaggcagcagcaagtatagataacagagtgcccactccagcttctgttgccgagctg
agctcgcagcaggcactgccagacatgaacagcactgaatccacatttcaaataaaaaag
gaagaagacgacaacactgtagggaaaaaacaagtggatataaaaatggaggatgatgaa
atcaaacctccattggcgaagaaggaggaaccagttatagcagaaccaaagcaggaaatg
accggaaatgactctgcggagaataagacagagatcaagacagaacccaaagaggaggac
gacaatggagctagtagcacgtcggctgcctccgccacgcagaatcgcaaaaaagttttt
aagccggaagagctgaggcaagccctaatgcctacactggaggctctttacagacaagat
ccagaatcactgcccttcagacaacctgtagaccccatgctattgggaatccctgactac
tttgatatagtgaagaatcccattgacttatccacaattaaacggaagttggacacgggt
cagtaccaggaaccctggcagtacgtggacgatgtgtggctcatgtttaacaacgcctgg
ctgtacaaccgcaaaacatcccgagtttataaatactgtacaaaactggcagaggtgttt
gaagcagagattgatcctgtcatgcagggcttgggctactgctgcggaaggaagtacgag
ttctcaccccaaactctgtgttgttatggcaagcaactgtgtacaatatccagggatggt
acttactacagctaccagaacaggtatcatttctgtgaaaagtgcttcaatgaaatccag
gggaacagtgtgactctgggggaagacccagcacaaccacagacgatgatatccaaagaa
cagtttgaaaagaagaaaaatgacacattggatgctgaaccatttgttgaatgtaaagac
tgtgggaggaagatgcatcaaatctgcgttctgcactacgatgtgatttggccatctggc
tttatctgtgataactgtctaaagaagtctggcaaaacaaaaaaggataacaaattttca
gccagaaggttgcaaaccacgaagttgggaacgtacattgaggacagagtgaataagtat
ttgaaaagacagaatcaccccgaggctggtgaagtgtttgtgcgagtggtggccagctca
gacaaaactgtggaaatcaagcctggcatgaagtccaggtttgtggacacaggggagatg
gtggagacctttccttacagaaccaaagcactttttgcatttgaggaaatagatggggtg
gacgtttgtttctttggcatgcatgtccaggaatatggctctgagtgtccctttcccaat
accagacgggtctacatatcatacctcgatagtgttcatttctttaaaccacgtttgctg
aggactgcagtgtaccatgagatcctaatagggtacctggagtatgtcagaaagcttggt
tatgtgactggtcacatctgggcgtgccctcctggtgaaggagatgactacatcttccac
tgtcacccacctgaccaaaagattcccaaacccaagaggcttcaagagtggtacaaaaaa
atgctggacaaggcttttgctgaaaggatcatacatgactacaaagacatttttaagcaa
gcaacagaagatagattgacgagtgccaatgaactgccatattttgagggtgacttttgg
cctaacgtactcgaggagagtattaaggagctcgaacaggaggaggaggagcgcaagaag
gaagaaaacacggcctccactgaaacaacagaaggagcccatccagacagcaagaatgcc
aaaaagaaaaataataaaaaaaccaacaaaaacaagagcagcatcagtcgagctaacaag
aaaaagcctggaatgcctaatgtagccaatgacctctcccagaaactctatgccactatg
gaaaagcataaggaggtgttttttgtaatacatctacatgctgggccagttatcaacaca
ctgccacccataattgaccctgaccctatgttgacctgtgacctgatggatggtcgagat
gcctttttgactctggcaagggacaagcactgggagttcagttcactaaggaggtgccaa
tggagcacgatgtgtatgctagtagaactgcacaaccagggccaggaccgctttgtgtac
acttgcaatgaatgcaagcaccatgttgagactcgctggcactgcaccgtctgtgaggac
tatgacctatgcattaactgctacaacgcaaagggccatgaacatcaaatggtgaagtgg
ggcctgggtctagatgatgatagcagtggtcaggggggagaggcctccaagagtccacag
gagagccgtcgcctcagtattcagcgctgtatccagtccttggtccatgcatgccagtgt
cgcaatgccaattgctctttgccatcatgccagaagatgaagagagtggttcagcacaca
aagggttgcaagcgcaagaccaatggaggatgccctgtttgcaagcagctcatcgcttta
tgttgttatcatgccaagaactgtcaagagaacaagtgtcctgttcccttctgtctcaac
atcaagcacaagctacatcagcagcagctgcagcacaggcttcagcaggctcagatgatg
cgccgcagaatggccaccatggctggaaggggcatgcccatgccatctccacctacctca
gctgcacctgatactcctaactctgcgcagcagccgaacacaccccagacccctcaacct
atgcccaatcagccccagcaacaccagcccccaaattctgctaatattgctcaaggcttt
gctaacagtcatggcagccagcccccaacaccggttccccagggcaaactggggccacag
tcctctcccctgcatcagcagcagtcccctctgcctaatatgccacatcaacagcagcct
cagcctccctcacagcagcagcagcagcagcaacaacaacaacaacaacaacaacaacaa
cagcagcagcagcaacagcagcctttgctggcagccctaaaagtggccagacagattgag
atggcagccaaagtaaagcagcagcaacagaattatgccatgaatggcataccgatgaac
caccctcgaatgatggggcccatgcagggccaaatgcagatgatgcaggggccgcgagga
ccccaggtcatgcaggctatgcagcagggccagtgggctccaggaatgcagaacccccag
ggtcatcaacaacaggttacttcacagcaaggccctatggtggctccccagcaggctcag
ggaactcccatgacccagcagggccaactcatgcagaggccaatgatgccacagcaacat
ggtctccaaatgcctggagtcatccctccccaagggccctcacagcagggcatgacacca
cagcagcataatatgccacgtgggatacctggaaatattgctcccagtgcactgcaggaa
ttattgcgtacacttaaatctcccaactctcctcagcagcaacaccaggtcctgaccatc
ctcaaatctaacccccacctcatggctgcgttcatcaaacagaggacggccaagtaccaa
gcaaaccagcaacagcagcaggtccaaccgcagcagaaccctcaggccatgatgggaccc
caagccggaatgcagagcatggcaggcatagcaaaccaggtaccgagacctggcatggca
cctcagcagcaatctcagcaggcaggcccccaggggatgccagccatgggccctcaaggc
cagatgatgaatactgcccaaaatggtaatcctcaactgtaccgcagacagcagcagctg
ctcaggatgcaacagatgcagcagcagggagcgatgcctcaaggccacggccagttcccc
caacagcagccaggcccagcgagctactcgcagctccggatgcagcagcaaatgactatg
caaggaggtgggggagccatgggacagcttcctcctacatcccaaatgggccaacctggc
atgggcatggacggtgcccagaacctcctccagcagcgcatgcttcagcagcagcagcag
cagcagcagcagcagcagcagcaactgttgaagcagcagatgggatctccagcgcagaca
aactcaatgagtccacaacctcacatgctccagggccagggccagggagccgctcactta
ccgggccaaaccatggcaaaccaggtgcgctcccctgctccagtgcaatctccccgtcct
ccttcgcagcagccgccacattccagtccatctccgcggatacagcctcagccctcgcct
cagcacagcgcgcttcactctggctccccccacccgagccttggaggacccatgtcaggc
tccatggagcagggacacatggggacgccagagcagagcgccatgctcccacaacttaac
acgccaaaccgagggggtctgaataatgacacaaatatggtgggtgacaccacaggagac
acgctagagagatttgttgaacaattgtag

DBGET integrated database retrieval system