KEGG   Takifugu rubripes (torafugu): 101078373Help
Entry
101078373         CDS       T02386                                 

Gene name
crebbp
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101078373 (crebbp)
   04330 Notch signaling pathway
    101078373 (crebbp)
   04350 TGF-beta signaling pathway
    101078373 (crebbp)
   04068 FoxO signaling pathway
    101078373 (crebbp)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101078373 (crebbp)
  Cellular community - eukaryotes
   04520 Adherens junction
    101078373 (crebbp)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101078373 (crebbp)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101078373 (crebbp)
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101078373 (crebbp)
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101078373 (crebbp)
Chromosome [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101078373 (crebbp)
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101078373 (crebbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 2449 aa AA seqDB search
MADNLLDVVGPPTAKRPKLNSPLSGSDGTDLVSLLDLENDLPDELIPNGDLGLGLSSNGG
PGGGGTGLHAVVPDAAAKHKQLSELLRSGSSSLSGSGTLQGGMVGSQLGAVLGKGPLGQG
STNHQAQKGGVAAGQGNGSPGMCFNQTMLNSGQGHGVMGQAGQVMNGTLGPAGRGRPGMQ
YQGQGMPSSQGAGVGGSVLAETLAQGGAQLGNHNVLNAQQAGTMNKMGMSGAPFGQQYGQ
AGVQQMGTAGVNGQQLQNKTALSNNLPQFSNELKGAGSVPNMPQLQQQVGSVGMVPGVGG
VSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQ
AGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNATDKRNQQSMLGSPGAGLQNPIST
VGPGQPTPTAISSAATHIDPSSMQRAYAALGLPYGNQSPAQVQGLSQQKLQGTQHQQLQN
MNPLGTNQINPMAGSMGVPSSDQTGMHSDGTLPTTVSNQLMPDGSIGGGVGNLPAAAPLS
ATGVRKAWHEHVTQDLRTHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESA
NSRDEYYHLLAEKIYKIQKELEEKRRSRLQKQPGMMGNAGPQQPVMTQSNAMGPGQTIRP
PNGPVSMPNMPNQILSRMQVPQGINQFNPIAMQNAQMSQAPMGARAPSPMNHPQQINMNS
VSTMGMSPSRMPQTQGMMGSHANNMVPQPANQGQFLSQGQFTAPAGGAMNVGLGQPKTQP
AVSQPQNANIPLNALGSLGSQLPCGPASQSPLRATPPPNTSASLQTQQQQQQQQQQHHHH
HHHLVSAQQQVPMQPPTPVSASGPSTTPTHIPSSLPSLPQAMSTTPEPSLPLTPLQPQTE
PSSQMQQPSSVQAQHPSTPSSQAAASIDNRVPTPASVAELSSQQALPDMNSTESTFQIKK
EEDDNTVGKKQVDIKMEDDEIKPPLAKKEEPVIAEPKQEMTGNDSAENKTEIKTEPKEED
DNGASSTSAASATQNRKKVFKPEELRQALMPTLEALYRQDPESLPFRQPVDPMLLGIPDY
FDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCTKLAEVF
EAEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTISRDGTYYSYQNRYHFCEKCFNEIQ
GNSVTLGEDPAQPQTMISKEQFEKKKNDTLDAEPFVECKDCGRKMHQICVLHYDVIWPSG
FICDNCLKKSGKTKKDNKFSARRLQTTKLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASS
DKTVEIKPGMKSRFVDTGEMVETFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPN
TRRVYISYLDSVHFFKPRLLRTAVYHEILIGYLEYVRKLGYVTGHIWACPPGEGDDYIFH
CHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSANELPYFEGDFW
PNVLEESIKELEQEEEERKKEENTASTETTEGAHPDSKNAKKKNNKKTNKNKSSISRANK
KKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIIDPDPMLTCDLMDGRD
AFLTLARDKHWEFSSLRRCQWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCED
YDLCINCYNAKGHEHQMVKWGLGLDDDSSGQGGEASKSPQESRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKNCQENKCPVPFCLN
IKHKLHQQQLQHRLQQAQMMRRRMATMAGRGMPMPSPPTSAAPDTPNSAQQPNTPQTPQP
MPNQPQQHQPPNSANIAQGFANSHGSQPPTPVPQGKLGPQSSPLHQQQSPLPNMPHQQQP
QPPSQQQQQQQQQQQQQQQQQQQQQQQPLLAALKVARQIEMAAKVKQQQQNYAMNGIPMN
HPRMMGPMQGQMQMMQGPRGPQVMQAMQQGQWAPGMQNPQGHQQQVTSQQGPMVAPQQAQ
GTPMTQQGQLMQRPMMPQQHGLQMPGVIPPQGPSQQGMTPQQHNMPRGIPGNIAPSALQE
LLRTLKSPNSPQQQHQVLTILKSNPHLMAAFIKQRTAKYQANQQQQQVQPQQNPQAMMGP
QAGMQSMAGIANQVPRPGMAPQQQSQQAGPQGMPAMGPQGQMMNTAQNGNPQLYRRQQQL
LRMQQMQQQGAMPQGHGQFPQQQPGPASYSQLRMQQQMTMQGGGGAMGQLPPTSQMGQPG
MGMDGAQNLLQQRMLQQQQQQQQQQQQQLLKQQMGSPAQTNSMSPQPHMLQGQGQGAAHL
PGQTMANQVRSPAPVQSPRPPSQQPPHSSPSPRIQPQPSPQHSALHSGSPHPSLGGPMSG
SMEQGHMGTPEQSAMLPQLNTPNRGGLNNDTNMVGDTTGDTLERFVEQL
NT seq 7350 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatcttctggatgtggtcggaccccccactgcaaagcgtcccaagctgaat
tcacctctctcaggatcagatgggacagacctcgtatctctgcttgacctggaaaatgac
cttccagatgagctcatcccaaatggagacttaggattgggactgtcctctaatggtggt
ccaggtggaggaggcactggcctccatgctgttgtccctgatgcagctgccaaacacaag
cagttgtctgaacttcttcggtcaggaagctcttctctttcgggatcgggcaccctacag
ggaggcatggtgggaagtcagcttggtgctgtgcttggcaaaggcccacttggacagggc
tctaccaaccaccaggctcagaaaggtggggtagctgctggacagggcaatggaagcccg
ggcatgtgcttcaaccagactatgctgaacagtggacagggtcatggggtgatgggtcaa
gctggacaagtcatgaatgggaccctgggaccagcaggtcgaggcagacctggcatgcag
taccagggtcaaggcatgccgtcttcacagggagctggagttgggggcagcgtgctggct
gaaacactcgcacagggtggagcgcagctcggtaaccacaacgtgctgaatgctcagcaa
gctggtaccatgaataagatggggatgtcgggggctccatttggccagcagtatggccag
gctggggtccagcagatggggacagcgggtgttaatggccaacaactacagaacaagaca
gcactttccaacaatcttcctcaattctccaatgagctaaagggagctgggagtgtgcca
aacatgccccagctgcagcaacaggtaggctcagtgggaatggtacctggggttggtggt
gtgtcggcaggtccaacagctgaccctgagaagcgcaaactcattcagcagcagctggtc
ctgttgctccatgcacataagtgccaacggcgggaacaggccaacggagaggtgagggcc
tgttcactaccccattgccgtaccatgaaaaacgtcctcaaccacatgacccattgccag
gctggcaagtcctgccaggtggctcattgtgcatcatcccgacaaatcatctctcactgg
aagaactgtacacggcatgactgtccagtatgcctgcctttaaagaatgctactgacaag
aggaaccagcaatccatgctaggttctcctggggctggcctgcagaatccaattagcaca
gtaggacccggtcagcctactcccacagccattagcagtgcagccacacacattgaccca
agctccatgcagagggcctacgctgcccttggtctgccatatgggaatcagtcccctgct
caggtccagggtctcagtcaacagaaactccagggcactcaacatcagcagctgcaaaat
atgaacccactaggcactaatcagataaacccaatggcaggaagcatgggtgtcccctct
tcggaccagactggcatgcactcggatggcacgctaccaactacagtcagcaaccagctg
atgccagatgggtcaataggaggtggtgtgggaaacttgcctgctgctgcccccctttct
gctacaggggtaaggaaggcctggcatgagcatgtcactcaggacctgcgcacccacctg
gtgcacaaacttgtacaagccatattccccacaccagaccctgcagcgctgaaggacaga
cgaatggagaacctggtggcatatgcccggaaagttgagggtgacatgtatgaatctgct
aatagcagggatgagtattaccatttactggcagagaaaatctacaaaattcagaaagaa
ctagaggagaagagacgatcacgactccaaaagcagcctggcatgatgggcaacgctggt
cctcaacagcctgttatgactcagtcaaacgccatgggccccggacaaacaatccgacct
cccaatggtcctgtgtctatgcccaacatgccaaatcagatattgagccgcatgcaggtg
cctcaaggaatcaatcagttcaacccaatagcaatgcagaatgcacagatgtcgcaggca
cccatgggagcacgtgctccatcccctatgaaccatccacaacagatcaacatgaactct
gtctcaacgatgggaatgtcgccctcaaggatgcctcagactcaaggaatgatgggtagt
catgccaataacatggtacctcaaccagcaaaccagggccagtttctgtcacagggccag
ttcacagcacctgcagggggagcaatgaatgtaggattgggccagccaaaaactcagcct
gccgtctcacagcctcaaaatgctaacatccctctgaatgcactgggatcacttggctcc
cagctgccctgtggccctgcatcccagagccctctgcgtgccactccaccacccaatacc
tctgccagcctgcagactcaacaacaacaacagcagcagcagcagcagcaccaccaccac
caccaccaccttgtttctgcacagcagcaggttccaatgcagcctcctacccctgtctct
gcgagtggcccctccaccacacccacacacatacccagtagcctccctagccttccacaa
gccatgagcacaacccctgaaccctccttgccgcttacacccctgcagcctcagacagag
ccttccagccagatgcagcagcccagctcagtgcaagcccagcaccccagcacgccgtca
tcccaggcagcagcaagtatagataacagagtgcccactccagcttctgttgccgagctg
agctcgcagcaggcactgccagacatgaacagcactgaatccacatttcaaataaaaaag
gaagaagacgacaacactgtagggaaaaaacaagtggatataaaaatggaggatgatgaa
atcaaacctccattggcgaagaaggaggaaccagttatagcagaaccaaagcaggaaatg
accggaaatgactctgcggagaataagacagagatcaagacagaacccaaagaggaggac
gacaatggagctagtagcacgtcggctgcctccgccacgcagaatcgcaaaaaagttttt
aagccggaagagctgaggcaagccctaatgcctacactggaggctctttacagacaagat
ccagaatcactgcccttcagacaacctgtagaccccatgctattgggaatccctgactac
tttgatatagtgaagaatcccattgacttatccacaattaaacggaagttggacacgggt
cagtaccaggaaccctggcagtacgtggacgatgtgtggctcatgtttaacaacgcctgg
ctgtacaaccgcaaaacatcccgagtttataaatactgtacaaaactggcagaggtgttt
gaagcagagattgatcctgtcatgcagggcttgggctactgctgcggaaggaagtacgag
ttctcaccccaaactctgtgttgttatggcaagcaactgtgtacaatatccagggatggt
acttactacagctaccagaacaggtatcatttctgtgaaaagtgcttcaatgaaatccag
gggaacagtgtgactctgggggaagacccagcacaaccacagacgatgatatccaaagaa
cagtttgaaaagaagaaaaatgacacattggatgctgaaccatttgttgaatgtaaagac
tgtgggaggaagatgcatcaaatctgcgttctgcactacgatgtgatttggccatctggc
tttatctgtgataactgtctaaagaagtctggcaaaacaaaaaaggataacaaattttca
gccagaaggttgcaaaccacgaagttgggaacgtacattgaggacagagtgaataagtat
ttgaaaagacagaatcaccccgaggctggtgaagtgtttgtgcgagtggtggccagctca
gacaaaactgtggaaatcaagcctggcatgaagtccaggtttgtggacacaggggagatg
gtggagacctttccttacagaaccaaagcactttttgcatttgaggaaatagatggggtg
gacgtttgtttctttggcatgcatgtccaggaatatggctctgagtgtccctttcccaat
accagacgggtctacatatcatacctcgatagtgttcatttctttaaaccacgtttgctg
aggactgcagtgtaccatgagatcctaatagggtacctggagtatgtcagaaagcttggt
tatgtgactggtcacatctgggcgtgccctcctggtgaaggagatgactacatcttccac
tgtcacccacctgaccaaaagattcccaaacccaagaggcttcaagagtggtacaaaaaa
atgctggacaaggcttttgctgaaaggatcatacatgactacaaagacatttttaagcaa
gcaacagaagatagattgacgagtgccaatgaactgccatattttgagggtgacttttgg
cctaacgtactcgaggagagtattaaggagctcgaacaggaggaggaggagcgcaagaag
gaagaaaacacggcctccactgaaacaacagaaggagcccatccagacagcaagaatgcc
aaaaagaaaaataataaaaaaaccaacaaaaacaagagcagcatcagtcgagctaacaag
aaaaagcctggaatgcctaatgtagccaatgacctctcccagaaactctatgccactatg
gaaaagcataaggaggtgttttttgtaatacatctacatgctgggccagttatcaacaca
ctgccacccataattgaccctgaccctatgttgacctgtgacctgatggatggtcgagat
gcctttttgactctggcaagggacaagcactgggagttcagttcactaaggaggtgccaa
tggagcacgatgtgtatgctagtagaactgcacaaccagggccaggaccgctttgtgtac
acttgcaatgaatgcaagcaccatgttgagactcgctggcactgcaccgtctgtgaggac
tatgacctatgcattaactgctacaacgcaaagggccatgaacatcaaatggtgaagtgg
ggcctgggtctagatgatgatagcagtggtcaggggggagaggcctccaagagtccacag
gagagccgtcgcctcagtattcagcgctgtatccagtccttggtccatgcatgccagtgt
cgcaatgccaattgctctttgccatcatgccagaagatgaagagagtggttcagcacaca
aagggttgcaagcgcaagaccaatggaggatgccctgtttgcaagcagctcatcgcttta
tgttgttatcatgccaagaactgtcaagagaacaagtgtcctgttcccttctgtctcaac
atcaagcacaagctacatcagcagcagctgcagcacaggcttcagcaggctcagatgatg
cgccgcagaatggccaccatggctggaaggggcatgcccatgccatctccacctacctca
gctgcacctgatactcctaactctgcgcagcagccgaacacaccccagacccctcaacct
atgcccaatcagccccagcaacaccagcccccaaattctgctaatattgctcaaggcttt
gctaacagtcatggcagccagcccccaacaccggttccccagggcaaactggggccacag
tcctctcccctgcatcagcagcagtcccctctgcctaatatgccacatcaacagcagcct
cagcctccctcacagcagcagcagcagcagcaacaacaacaacaacaacaacaacaacaa
cagcagcagcagcaacagcagcctttgctggcagccctaaaagtggccagacagattgag
atggcagccaaagtaaagcagcagcaacagaattatgccatgaatggcataccgatgaac
caccctcgaatgatggggcccatgcagggccaaatgcagatgatgcaggggccgcgagga
ccccaggtcatgcaggctatgcagcagggccagtgggctccaggaatgcagaacccccag
ggtcatcaacaacaggttacttcacagcaaggccctatggtggctccccagcaggctcag
ggaactcccatgacccagcagggccaactcatgcagaggccaatgatgccacagcaacat
ggtctccaaatgcctggagtcatccctccccaagggccctcacagcagggcatgacacca
cagcagcataatatgccacgtgggatacctggaaatattgctcccagtgcactgcaggaa
ttattgcgtacacttaaatctcccaactctcctcagcagcaacaccaggtcctgaccatc
ctcaaatctaacccccacctcatggctgcgttcatcaaacagaggacggccaagtaccaa
gcaaaccagcaacagcagcaggtccaaccgcagcagaaccctcaggccatgatgggaccc
caagccggaatgcagagcatggcaggcatagcaaaccaggtaccgagacctggcatggca
cctcagcagcaatctcagcaggcaggcccccaggggatgccagccatgggccctcaaggc
cagatgatgaatactgcccaaaatggtaatcctcaactgtaccgcagacagcagcagctg
ctcaggatgcaacagatgcagcagcagggagcgatgcctcaaggccacggccagttcccc
caacagcagccaggcccagcgagctactcgcagctccggatgcagcagcaaatgactatg
caaggaggtgggggagccatgggacagcttcctcctacatcccaaatgggccaacctggc
atgggcatggacggtgcccagaacctcctccagcagcgcatgcttcagcagcagcagcag
cagcagcagcagcagcagcagcaactgttgaagcagcagatgggatctccagcgcagaca
aactcaatgagtccacaacctcacatgctccagggccagggccagggagccgctcactta
ccgggccaaaccatggcaaaccaggtgcgctcccctgctccagtgcaatctccccgtcct
ccttcgcagcagccgccacattccagtccatctccgcggatacagcctcagccctcgcct
cagcacagcgcgcttcactctggctccccccacccgagccttggaggacccatgtcaggc
tccatggagcagggacacatggggacgccagagcagagcgccatgctcccacaacttaac
acgccaaaccgagggggtctgaataatgacacaaatatggtgggtgacaccacaggagac
acgctagagagatttgttgaacaattgtag

DBGET integrated database retrieval system