KEGG   Takifugu rubripes (torafugu): 101078389Help
Entry
101078389         CDS       T02386                                 

Definition
glutamate receptor, ionotropic kainate 4-like
Orthology
K05204  
glutamate receptor, ionotropic kainate 4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101078389
Ion channels [BR:tru04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   101078389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 967 aa AA seqDB search
MLTAWVLLLFLAMLVRSTTGGSLSFRIAAILDDPMECNRGERLAITLAKESINKNTNRST
TGKLEVDIFELLRDSEYEMGETMCQIMSKGVVAVLGPSASPASNSIISNICGEKEVPYVK
VAPEDILKVHYPRFTTLDLRPTNTDISLAVAGLLTFFNSTTTCLICAQADCLLNLEQLLR
RFLISKETLSVRVLDDSQDPTPVLKEIRDDKTATIVVDANTTMSHIILERASELGMLSVY
YTYIFTSLEFSLLQLDDVADQRVNIIGFSVFNKTHPFFQDFVISLNRSWQENCDHAPFAG
IPLSSALFFDAVYTVVAAVQELNRSQNVGATQLSCKSSKIWEHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALRIMQNSQDGLRQIGLWHSEDGLSMERTLPSINVTDTLFNTTLTI
TTILENPYVMLRQNHQDLEGNDRYEGFCVDMLKELADILKFKYRIRLVGDGHYGVPGANG
TWTGMVGELISRKADLAVAGLTITAEREKVIDFSKPYMTXGISIMYRVHLGRRPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYNPHPCIKGRCNLLINQYSLGNSFWFP
VGGFMQQGSAIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLA
DQTAIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMHSKQPSVFVKSTEEGIARVLKSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPLGSVYRDEFDLAILKMQEDNRLEILK
RKWWDGGKCPKEEDHRAKGLGMENIGGIFVVLVCGLLVAILMAVLEFVWMLRQTPGNEHS
ACEEMLRELQGIVLCHNGLQVRRRRAASAMRPRPLPLEERRARAATVSLSNGKLCGGTGL
PEPLSHRLAQEAALVARGCSHIRICPECRRFQGLRMRPAAATGALPSPTHSDESIEWDKT
TNSSEPE
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgctcacagcctgggtgcttctgctcttcttagccatgttggtgagaagcaccaccggt
gggtcgctctccttcagaatagctgccatccttgatgacccaatggagtgcaacagaggg
gagcgcttggccatcacactagccaaagaaagcatcaacaaaaacaccaaccgctccact
actggcaagctggaggtggatatctttgagctgctgagggacagcgaatatgagatgggg
gaaacaatgtgccagatcatgtccaaaggcgtggtagctgtccttggcccctctgccagc
ccggcttcaaactccatcatcagcaatatctgcggagagaaagaggtgccctatgttaag
gtggctccagaggacatcctcaaggttcactatccccgcttcaccactctggacctgcga
ccgaccaacacagacatcagcctggccgtggccggcctcctcaccttcttcaacagcacc
accacctgcctcatctgcgcacaggccgactgccttctgaacctggagcagctcctccgg
cggttcctcatctcaaaggagacgctgtcggtgcgcgtgctcgatgacagccaggacccc
acccctgtgctgaaggagatacgagacgacaagacggccaccatcgtagtagacgccaac
accaccatgtcacatattattctggagcgggcctcagaactgggaatgctgtcagtctac
tacacatacatcttcacctctctggaattctccctactccagctggacgacgtagcggac
caacgggtcaacatcatcggattctcggtgttcaacaaaacgcatccctttttccaggat
ttcgtaatcagtctgaatcgctcctggcaagaaaactgtgaccacgcacccttcgctggg
atcccgctctcctccgctctcttctttgatgcggtgtacaccgtggtggcggcggttcag
gagttgaaccgtagccagaatgttggcgccactcagctctcgtgcaagtcctccaagatc
tgggagcatggcaccagcctcatgaactacctgaggatggtagaattggaaggtctaacg
ggccacattgaattcaacagcaaaggccaacgatcaaattacgccctgcgaatcatgcag
aacagccaggacggcctcaggcagattggcctgtggcactcagaagatggactgtccatg
gagagaacgcttccatcaatcaatgtgacggacacgctcttcaacactacgctcaccatc
acaacaatattagagaatccctacgtgatgctgcggcagaaccaccaggatctggagggg
aatgaccgctatgaaggcttctgcgtggacatgctcaaggagctggcagacattctcaag
ttcaaatatcgcatccggctggtaggggacggacactacggggtcccgggagctaacgga
acatggaccggcatggttggagagctcatatcgaggaaagctgacctcgcagtggccggc
ctcaccatcaccgcagagcgtgaaaaggtcatcgacttctccaagccctacatgaccntg
gggatcagcatcatgtaccgagtccacctgggacggaggccaggttatttctccttcctg
gaccctttctcccctggtgtttggcttttcatgcttctggcctacttggccgtcagctgt
gtcctctttctggtggcgaggttgacgccatacgagtggtacaatccccacccctgcatt
aaaggccgctgtaacctactgatcaaccaatactctctcggcaacagtttttggttccca
gttggaggtttcatgcagcagggatctgctattgctccccgggctctgtctacccgttgt
gtcagcggagtctggtgggctttcacgttaatcatcatctcatcctacactgccaacctg
gctgccttcctgacggtccagaggatggaggtgcccatagagtcagtggatgacctggca
gatcagacagccatagagtacggcaccatgcatggaggatctacgatgaccttcttccag
aactctcgataccagacctaccagcgtatgtggaacttcatgcactcgaagcagcccagc
gtgtttgtgaagagcacagaggagggcatcgcacgtgtcctcaagtcaaactacgctttc
ttgctggagagcaccatgaatgagtactaccgccagaggaactgcaatttgacccagatc
ggaggccttctggacaccaaaggctacggcatcggcatgccgctggggtcagtctaccgt
gatgagtttgacctggccatcctcaaaatgcaggaggacaatcgtctggagatcctcaaa
agaaagtggtgggatggcggcaaatgcccaaaggaggaggaccaccgggcgaaaggcctg
ggcatggagaacatcggtggcatctttgtggtgctggtgtgcggcctgctggtggccatc
ttaatggcggtgctggagtttgtatggatgttgaggcagaccccaggaaatgagcattcg
gcatgcgaggaaatgctgcgcgagctccaggggatcgttctgtgccacaacggcctgcag
gtgaggcgcaggcgggcagcctcggcgatgcggccgcgacctttgcccttggaggagcgt
cgggcgcgagccgccaccgttagcctcagcaacggcaagctgtgtggtggcactggactc
ccagagcccctctcccacagactggcccaggaggcggccctggtggccaggggatgcagc
cacattcgcatttgtcccgaatgccgacgattccagggactgaggatgcgtccggcagcg
gccacaggggcgcttccttctcccacacacagtgacgagagcatagagtgggacaagacc
acaaacagtagtgaacctgaataa

DBGET integrated database retrieval system