KEGG   Takifugu rubripes (torafugu): 101078475Help
Entry
101078475         CDS       T02386                                 

Definition
histone-lysine N-methyltransferase ASH1L-like
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Tight junction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101078475
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    101078475
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101078475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 2782 aa AA seqDB search
MDSKIQGGNGTPPPVLSGSPTGDREKEGGGGKKEEEEDNRDRDKDGAAAASAGGAGASGP
GVTGDDQSHFSIRESSVSEGNVKLKIGLQAKRMKKPPKILENYVCRPAFRATVRHTGRGA
ASSRGKGTSNNESGSQSQSPSQGREKEKDKSPSVNRPAPSSSSSSSSSNTSAKAPTPPPT
APPLSSTTTVTPSQLNGSALTKRGSPKMDFKSDAKPDTKATIVSEKPLNLHRPPSDNKTL
NAGKKTPVSQFNPRSSSTSPPLPASKEAAFEGIKPSQYSYSTDGQRDKGIQNWGAPTVTE
KLAQLIAICPPSKTPKPAKSAKSDPAPLPSSGFMAPTAKQRDRAMANRNTYSRMVHLSPP
PPVSRPPGRPYGSRSKDGVMETSSTMTSFTSDDAEGSVKASSAGNISSSSGSSSRSSSPA
LIYGNNRSDNSSSSISKAQSRAIHTAASSSCPISSSSAISPEQRTISAVSHLGSPAPSQG
HHAHESPALAEESSAGMTEQERNSPRDFSKFPPAPGMGKSEGRDKPTISQLLNIQRGKSS
SPSKRSPNRDNSRSGQASSLAETVRELSSPEPDVEDSPQTPLRDDSPDSSIDSPNEQESK
PLKKRRGRKPRWNRLMIKAQGHRAGEGSVFGHTKTNLPLSSSFELPSPPIKRPVGRPPNP
NKIKQVSLSQSSVSQLFPPQAKKRGRPKSKMPRLDAPTRGCLSHKLVASKVFSLKSKEEQ
DPPVLHPEVDLNPPKPLPRKRGRPKRLPPTLPQEGQPPTLAPESGEMGDRFFHSKGNGQL
IMKTIIGKINKMKSMKRKRILSQILSSSVSVSSAETATQSLSTLAASFGGKLGPQINVSK
KGTIYMGKRRGRKPKATTATSADSFLSPNTSSPFHHHHLQSQQHLSSSEIFPSPSLSQSS
GGHSPISDSFVEPGSVHFHSHNAHHGHNTLSFPPPTFSAPNPRSLGLGSMASSMAAAASQ
KKSTCRGYHHHHHHYRQHFHYHKLSPPRPLHPTSPAPLNELKEATPSPVSESHSEETVPS
DSGIGTDNNSTSDRGEKAGGGRRRHSAVLLEHPSPSPSPHGARSSPDPRRSHAAAPASSL
MGHKEKHKHKCKRRSHGCPGYDKLKRQKRKRKKKYLQLRSRRHDPDFLAELDEIVVRLSE
IRVSHRGPPSHHYVHRDLLPTIFRVNFGSFYSHPAYSCDPLHYVRKPDMKKKRGRPPKLR
ESMSEVPFVPGLGFPLSSGGFYHPSYGVPYSSGPLGLGYYRGYPPASALYPHPHHQSPHA
APSHHSHHSPTFPPPPPSSYMHHHHGSHLLLNPSKFHKKKHKLLRQEYLGSGRSPVLYPP
MSSELSFNWHHKHKHRHKHRERCADDDREETARGGSESRLGAGISDSGAIGKGERVSSLG
MAESLQRCRFGRDPSSVTANKQAASASANSPSSSSSSSAAERYKRKENSASCIGPSRLAL
STSKSHHPVESWFKMGSSKTEYSKLSHAHVAQGQGLFSDGRADNPAGCSESEDEEPLTPT
EEVEARDSPNHTNLFASALTRTSIKGSKSRKTEAVRESSTFSRVDRPVRKDRSTSVEKRE
SGSSGVQTRGVTLSTSEGPELSLHHRQQQHHHQPSLFHTHGSGSSSYLTPSQNCCLDAPV
PHHSYRAPPSKHSLHHVNKILRAKKLQRQARTGNNVVKKRGPGRPRKHPLPSPPPSPPPM
AEMNLAQQRDREHLAGGRGWDGDSVIDTIESVVQGQRKKAPKRKHWDRDGNEEDAEEERE
DKEIVEGNEHIGDREENLASLVARPSTGTSRNWLTQDKLQHFHGSVESKPDGQCPPECQG
PVPTEPAPPVPITSQREKRPARPPKKKFQKAGLYSDVYKTDDPRSQLLQLKKEKLEYIPG
EHEYGLFPAPIHVGKYLRQKRIDFQLPYDILWLWKHDQLYKRPDVPLYKKIRSNVYVDVK
PLSGYETTTCNCRTPNDRIEKSCLDDCLNRMSFAECSPSTCPSADQCDNQHIQRHDWVQC
LERFRTEGKGWGIRTKEPLRAGQFIIEYLGEVVSEQEFRSRMMEQYFSHSGNYCLNLDSG
MVIDSYRMGNEARFINHSCEPNCEMQKWSVNGVYRIGLFALGEIPSGTELTYDYNFHSFN
TEEQQACMCGSESCRGIIGGKSQRINGLPVKAAGARRLGRLKEKRKSKHQLKKRKSCVSL
QEEESSDSNKFYPHLMKPMSNRERNFVLKHRVFLLRNWEKMREKQELLKREGERERDASS
LSIYARWGGVIRDDGNIKSDVFLTQFSALQTSRSVRTRRLAAAEENTEVTRTARLAHIFK
EIWDMITSYKDSAGQTLAAPLVNLPSRKRNSQYYEKVSDPLDLSTIEKQILTGHYKTVEA
FDTDMLKVFRNAEKYYGRKSSVGRDVCRLRKAYYSARHEAAVQIDEIVGETVSEADSSDS
LERDHGHQHHAGGSHDKDDDVIRCICGMYRDEGLMIQCEKCMVWQHCDCMRLETEVEHYL
CEQCDPRPVEREVPMIPQPSYAQAGSVYYICLLRDDLLLHQGDCVYLMRDSRRTPEGPPL
RQSYRLLSHVNRDKLDIFRIEKLWKNEKGERFAFGHHYFRPHETHHSPSRRFYKNELFRM
PLYEIIPLEAVVGTCCVLDLYTYCKGRPKNVKEQDVYICDYRLDKSAHLFYKIHRNRYPV
CTKQYAFNHFPKRLTPKRDFSPHYVPDNYKRNGGRSAWKSERPKGATGCEDDGSSCGRGD
DFPPEAEDQRGGEGDVDVAAGDPEPVLGRREAQRERLNKILLDLLHRTPNKNAIDVTYLL
EEGAGRRLRRRTLGFGDFVGRK
NT seq 8349 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaagattcaaggggggaatggaaccccaccccctgttctctcaggttcaccc
accggggatagagaaaaggagggagggggcggaaagaaagaagaggaggaggataacaga
gacagagataaggacggagcagccgctgcttctgcaggaggagcaggagcgagtgggcct
ggggttactggagatgatcagtcccatttctccatcagagaaagcagcgtgtcagagggc
aacgtcaaactgaagattggccttcaagccaagcgtatgaagaagccccctaaaatcctg
gagaattacgtgtgccgaccagccttcagggccaccgtgaggcacacggggcgcggcgcc
gccagttcccgtggaaaggggacctcaaataacgagtctggcagtcaaagccagagtcct
tcgcaaggcagggagaaagagaaggacaagagtcccagcgtcaacagaccagcaccatcg
tcatcgtcgtcatcatcatcatcaaacacctctgcgaaagctccaaccccacctcccaca
gcgccccctctttccagcaccaccaccgtcacaccctcccagttgaatgggagcgctctc
acaaaaaggggctctccgaaaatggatttcaagtctgatgcaaagccagacacaaaagcc
accattgtgtctgagaagccccttaaccttcaccgccctccatcggacaacaaaaccctg
aacgctgggaagaaaacgccagtttcgcagttcaacccgcgctcatcgtcgacgtccccg
ccgctccctgcatcaaaggaagctgcatttgaagggatcaaaccttcacaatacagctac
agcactgatggtcagagagacaagggcatccaaaactggggagcacctactgtgactgaa
aaattagctcaactcatagcaatttgcccaccatcaaagacccccaaaccggcaaaatct
gcaaagagtgatcccgcccctctcccgagttcaggcttcatggcacccacagccaagcag
agagacagggccatggccaaccgcaacacatattcaagaatggtacacctttctccccca
cctcctgtgtcaagaccacctgggcgaccctatggatccaggagcaaagatggcgtcatg
gaaacttcctccacaatgacatcatttaccagcgatgatgcagaggggagtgtgaaggcg
agcagtgccggtaacatcagcagcagcagcggcagcagcagtcgaagcagcagcccggct
ctcatctacgggaacaaccgcagcgacaacagcagcagtagcatttctaaggcgcagtca
cgtgccattcacaccgccgcctcgtcgtcttgtccaatatcatcatcttctgccatctca
cctgagcagagaacaattagtgccgtgagccatttgggctcccctgctccatcccaagga
caccatgcacacgagagtcccgctttggcagaagaaagcagtgcaggtatgacggagcag
gagagaaacagccccagagacttctccaagttccctccagcaccagggatgggaaagtca
gagggacgagacaagccgaccatcagtcagctactgaatattcaaagggggaagagctct
agtccgagtaagcgcagtcccaatcgggataacagccggtctggtcaagctagcagcctt
gctgagactgtaagagaactgtcttcaccggaaccggatgtcgaagatagcccacagact
ccgcttcgagatgattcccccgactcatctatagactctcccaatgagcaggaaagcaaa
ccgcttaaaaaaaggagaggacggaagccccgctggaaccgcctcatgatcaaggcacag
ggtcatagagcaggggaaggcagcgtgtttggtcacaccaagacgaacttgcctctatct
tcaagctttgagttgccatcgccacccattaaaagaccagtggggaggcctcccaatcca
aacaagatcaagcaagtttccttgtcacaaagctcggtgtcacaactcttcccaccccag
gctaaaaaaaggggaaggcccaagtcgaaaatgccaaggctggacgctccaacccgcgga
tgtctgtcccacaagttggttgcgtctaaggtcttttcgctaaaatcgaaagaagagcaa
gacccccccgttcttcacccagaagtggacctgaacccccctaaacctttgcctagaaaa
cgtggacggcccaagcgccttcctcccaccttacctcaggaggggcaacctccaactttg
gctccagagtcgggggaaatgggagacaggtttttccacagtaaaggcaacggacagctc
ataatgaaaacaattattggcaagatcaataagatgaaaagtatgaaacgaaagcgtatc
ctcagtcaaatactctcctccagtgtctctgttagctcggcagaaactgcaactcagtca
ttgtctactttggctgcttcttttggggggaaactaggcccacaaattaatgtcagtaaa
aaaggcacaatatacatggggaagaggagaggccgtaaaccaaaggctaccactgcgaca
tccgcagactcctttctctccccaaacaccagttcccctttccaccatcatcatttacag
tctcagcaacatctctcctcctcagagatcttcccctctccatctctctcacagtcaagt
ggaggtcacagtcccatcagtgatagtttcgtggagcccggctcggtgcattttcactct
cacaacgcccatcatggtcacaacacgctctccttccctcccccgactttttcagccccc
aatcctcgcagcctgggcttgggctcgatggcgtcctctatggccgctgcagcgtcccag
aaaaagtcgacgtgtcgcggatatcatcaccaccaccaccattacaggcaacatttccat
tatcataagctttcccctcctcgacctcttcatcctacctcacctgctccccttaacgag
ctaaaagaagccactccgtcaccggtgagcgagtcacacagtgaggagacagtgcccagt
gacagtggtataggaacagacaacaacagcacctctgatcgtggggagaaagccggagga
gggaggcggcggcattctgctgtactcctggaacatccctcaccctctccatcaccccat
ggtgcaagatcatctcctgatccacggaggtctcacgcggcagctcctgcctcctcgtta
atgggacacaaggagaaacataagcacaagtgtaaacgccgcagccacgggtgccccggc
tatgacaaactaaagaggcagaaaaggaaacgcaagaagaaatacttgcagctacgctct
cggagacacgacccagactttctcgctgagctcgatgaaattgttgtcagactgagtgaa
atacgggtatcgcaccgcggccctccttcacaccattatgtccacagggacctgctgcca
acaatatttagagttaattttggcagtttctactcccatcccgcgtactcctgtgaccca
ttgcactatgttcgtaagcctgacatgaagaagaaacggggccgacctcccaaattgagg
gagtccatgtctgaagttccatttgtacctggtcttggatttccgctctccagcggaggc
ttctatcacccttcctatggtgttccgtactcctctggaccgctggggttaggttactac
cgaggctatcccccagctagcgctctctacccccatccacaccaccagtcgccccacgca
gccccgtctcaccattctcaccactcgccaactttccccccgcctcccccgtcatcttac
atgcatcaccaccatggctctcatctcctgctaaacccctctaaatttcacaagaaaaaa
cacaagctcctcaggcaggagtacctgggaagtggaagatctcctgtcctttacccaccc
atgtcctctgagctttctttcaactggcaccataaacacaaacacagacataaacacaga
gaacgctgtgctgatgacgaccgagaggagactgcgaggggaggatcagagagtcggctt
ggtgcggggatttccgacagtggagccataggaaaaggcgagagggtcagcagtttaggt
atggcggagtctttacaaagatgccgatttggccgggatccctccagcgttactgccaac
aagcaagctgcttcagcttctgccaactccccatcttcctcatcttcttcatcagcagca
gagaggtataagcgcaaagagaactctgcgtcctgtataggaccgtccaggcttgcgctc
agtacctctaaaagccatcacccagtagagtcctggttcaagatgggcagctccaaaacg
gagtactcgaagctttctcatgctcatgtggcacaaggtcagggtcttttctcagatgga
agggctgataatccggcaggttgttcagaaagtgaggatgaggagcctctcacccccaca
gaggaggtggaagccagagattctccgaaccacaccaatctgtttgcttctgctctcaca
cgcacctcgataaaagggagtaaaagcaggaagactgaggccgttcgggagagctccact
ttctcccgtgtggaccggcctgtgaggaaggaccgttcgacgtcggtggagaagagagag
tcggggtcatcaggtgtccagacaagaggagtcaccctctcgacgtctgaagggcctgag
ctgtccctccaccaccggcagcagcaacaccaccaccagccctccctgtttcacactcac
ggctctggttcttcctcctacctcaccccctctcagaactgttgcctggatgcccccgtg
ccccaccactcctatcgcgcacctccatccaaacacagcctgcaccacgtgaacaagatc
ctgcgggccaagaagctgcagcgacaggctcgcacggggaacaacgtcgtgaaaaagagg
ggtcccggacggccacggaaacacccgctcccctcccctccaccatctccaccacccatg
gcggaaatgaacctcgcccagcagagagaccgagagcatctggcagggggcagagggtgg
gacggtgacagcgtgatagacactattgagtcagtagttcagggccagcgtaaaaaagct
ccgaagcgaaagcactgggacagagatgggaacgaggaggatgcggaggaggaacgagaa
gacaaagagatcgtcgagggcaatgaacacataggagacagagaggagaacctggccagc
ctggtggcaaggcccagtaccggcacatcaaggaactggttgacccaggacaagcttcag
cactttcacggttctgtggaaagcaagccggatggccaatgccccccagaatgccaaggc
ccggtccccacagaaccagcgccacctgtgccaataaccagccagcgtgagaagagacca
gctagaccaccaaagaagaaattccagaaggcagggctttactccgatgtgtacaagacc
gatgaccctcggagtcagcttctgcagctaaagaaagagaagttagagtacatacctgga
gaacatgagtatggactgtttccagctccgatacatgttggaaagtacctgaggcagaaa
cgcattgattttcagttgccttatgacatcttatggctgtggaaacatgatcagttatac
aagaggcccgatgtccctctgtacaaaaagataagatcaaacgtctacgtggacgtgaag
cctctgtctggttatgagacgacgacatgcaactgtagaacgcccaatgatcgaatcgaa
aaaagctgcctggacgattgcctgaataggatgagttttgccgagtgctctccgagcacc
tgtccgtctgctgatcagtgtgacaatcagcacatccaaagacacgactgggtccagtgc
ctggagcggttccgcaccgaggggaaaggctggggcattcgtaccaaggagcctctccgg
gctgggcagtttatcattgaatacctcggcgaggtggtcagtgaacaggagtttaggagc
cgtatgatggagcagtacttttcccacagtggcaactattgtttgaacctggatagtggt
atggtgatagacagctaccggatgggaaatgaggcacgcttcataaaccacagctgtgaa
cccaactgtgagatgcagaagtggtctgtgaatggagtttacaggattggtctttttgct
cttggcgagatccccagtggcaccgagctcacctatgactacaacttccactctttcaac
actgaagagcagcaagcgtgtatgtgtggttccgagagctgccgcggcatcatcggaggc
aagagccagcgcattaatgggctgcccgtgaaggccgcaggggctcgacgcctgggccgg
ctcaaggagaagaggaagtccaaacaccagctcaagaagagaaaaagttgtgtttctcta
caggaggaagagtcgagtgacagcaacaagttttatcctcatctcatgaagcccatgtcc
aacagagagaggaactttgtgctgaagcaccgtgtgtttctcctgagaaactgggagaag
atgagggagaaacaggagctgctgaagagggagggggagagagaaagggatgccagcagc
ctctccatatacgcccgctggggaggagtcatccgtgacgatggcaacatcaagtcagac
gtcttcctgacgcagttttccgccctgcaaacttcccgttcggtccgcacgcgacgactc
gccgcggctgaagaaaacaccgaagtcacacgcaccgcacgccttgcacacatcttcaaa
gagatttgggatatgatcaccagctacaaggattcagccggtcagacactcgctgccccg
ctggtgaacctcccatccaggaagaggaacagccagtattatgagaaggtgtctgaccct
ctggacttgagcactattgagaagcaaatcctcacgggccactacaagacggttgaagcc
ttcgacacagatatgctgaaggtgttccgcaatgcagagaaatattacggcaggaagtca
tcggtaggcagagatgtttgccgtttgcggaaggcctactacagcgctcgacacgaggct
gccgtccagatcgatgagatcgtcggcgagacggtcagcgaggccgacagctccgattcg
ctggaacgcgaccacggccaccagcaccatgcgggagggtcccacgacaaggacgatgat
gtcatccgttgcatttgtggaatgtacagggacgaaggcctcatgatccagtgcgaaaag
tgcatggtgtggcagcactgtgactgcatgcggctggagaccgaggtggagcactacttg
tgtgagcagtgtgaccccaggcccgtggaacgggaggttccgatgataccgcagccgagc
tatgcccaagctggttctgtttactacatctgcctcctgagagacgacctgctgctacat
caaggcgattgtgtttatctgatgagagacagcaggcgcacacctgagggcccaccgctc
agacagtcataccgcctcctgtcccacgtcaaccgagacaagctggacatcttcaggatt
gagaaactctggaagaatgagaagggggagaggtttgcctttggccaccactacttccgt
cctcatgaaacacaccactctccgtcacggcggttctacaagaacgaactcttccgaatg
ccgctgtatgagatcatcccgctggaggcagtggtgggaacgtgctgtgtcctcgatctc
tacacgtactgcaagggccggccgaagaatgtgaaggagcaagatgtgtacatctgtgat
taccgcttggacaagtcggctcacctgttctacaagatccatcgcaaccgctacccagtg
tgcaccaagcagtatgccttcaaccacttccccaagaggctcacgcctaaaagagacttc
tcgcctcattatgttccggacaactacaagaggaacggcggccgctctgcctggaagagc
gaacgacccaaaggagccacgggctgcgaggacgacggctcttcctgcggacgtggcgat
gacttcccaccagaggccgaagaccagagaggaggcgagggcgacgtggatgtggctgca
ggggaccctgaaccagtgctgggcaggagagaggcgcagagggaacgactcaacaagatc
ctgctggatctgctgcacagaacccccaataaaaatgccatagacgtcacgtaccttctg
gaggagggcgccggacggcggctacggcgacggacacttggatttggcgattttgtgggg
agaaaatga

DBGET integrated database retrieval system