KEGG   Takifugu rubripes (torafugu): 101078548Help
Entry
101078548         CDS       T02386                                 

Definition
mitogen-activated protein kinase 9-like
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101078548
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101078548
   04012 ErbB signaling pathway
    101078548
   04310 Wnt signaling pathway
    101078548
   04068 FoxO signaling pathway
    101078548
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    101078548
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101078548
   04621 NOD-like receptor signaling pathway
    101078548
   04622 RIG-I-like receptor signaling pathway
    101078548
  Endocrine system
   04910 Insulin signaling pathway
    101078548
   04920 Adipocytokine signaling pathway
    101078548
   04912 GnRH signaling pathway
    101078548
   04914 Progesterone-mediated oocyte maturation
    101078548
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101078548
   05168 Herpes simplex infection
    101078548
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101078548
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101078548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 420 aa AA seqDB search
MSEEEGHFYSVQVGDSTFTVLKRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDANLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEVLG
TPNLEFMNRLMETVRNYVMNKPQYPGVSFTELFPDWAFPSDSEHDKLKTSQARDLLSKML
VIDPECRISVEEALNHPYIHVWYDPAEADAPPPQISDKQLEEREHTIEQWKELIYEEVID
WEERNKNGLMKEDCSDVVSVSASQSSSANDISSMSTEQTLASDTDSSSIDTLTGPLDECQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggaagaggggcatttctacagtgttcaggtgggagactccaccttcactgtc
ctcaaacgctaccagcagctccgtgccatcggctcgggggcccagggtatcgtctgctct
gctctggacacagtgctcggtataccagtggcagtgaaaaagttgtgccggcctttccag
aaccagacccatgccaagcgtgcctacagggaactggtgctgctcaaatgtgtcaaccac
aagaacatcatccgtctgatcaatgtgttcacgcctcagaagtccctggaggagttccag
gacctttaccttgtgatggagctgatggacgccaacctgtgtcaggtgatccacatggac
ctggaccatgagaggatgtcctatctgctgtaccagatcctatgtggcatcaggcacctg
cactctgctggcatcattcacagggacttgaagcccagtaacatcgtggtgaagtcagac
tgcactctaaagatcttggattttggtctggctaggacggcctgcactaacttcatgatg
accccctacgtggtgaccagatactaccgtgccccagaggtcatactgggaatgaagtac
aaggaaaatgtggacatatggtcagtggggtgcatcatgggagaaatggtgaagggcagc
gtcatcttccagggcaccgaccacatcgaccagtggaataaggtcattgaggttctgggc
acacccaacctggaatttatgaaccgactgatggagactgttaggaactacgtgatgaac
aaaccacagtatcccggagtcagcttcacagagctcttccccgactgggcttttccttct
gactcggagcacgacaagttaaaaacaagtcaagcacgggacctgctgtccaaaatgctg
gtcattgatccagaatgccgcatctctgtggaggaagccctcaaccacccgtacatccat
gtgtggtacgatccggcagaggcggacgcgcctcctccccagatatcggataagcagctg
gaagaaagagagcacacgatcgagcagtggaaagagctcatttatgaggaagtgattgac
tgggaggagaggaacaagaatggactaatgaaagaggattgctcagacgtggtgtcggtc
tccgcctcccagtcgtcatctgccaacgacatctcgtccatgtccacggagcaaaccttg
gcctccgacacagacagcagcagcatcgacacactgacgggaccgctggacgagtgtcag
tga

DBGET integrated database retrieval system