KEGG   Takifugu rubripes (torafugu): 101078679Help
Entry
101078679         CDS       T02386                                 

Definition
mitogen-activated protein kinase kinase kinase 12-like
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 893 aa AA seqDB search
MSGTCIHEPRAPSPSLSGFSTPISEPLYRRLDGDTPACTPETDLTPTQCVLRNVLSIDTG
AQVVPGGSSPTPSDGPSAHFDNSVLKLHEHEACQCGGGAEAGHSPEAGAVRSQSENIRLQ
SGSGGFLEGLFGCLKPVWTMIGKAYSTEHKHSNEESWEVPFEEISDLQWVGSGAQGAVFL
GKFHGEEVAVKKVRDIKETEIKHLRKLKHPNIITFKGVCTQAPCYCILMEYCAQGQLYEV
LRAGRKITPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSKEL
SDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEIPYKDVDSSAIIWG
VGNNSLQLPIPESCPDGFKILLRQCWNCKPRNRPSFRQILLHLDIASADVLSTPQETYFK
SQAEWREEVKRHFEKIKSEGTCLHRLDEELINRRREELRHALDIREHYERKLERANNLYM
ELSAVMLQLELKEKELQRREQSLDKKYPGLFKHHSSRQSSSSNTMDKLIKKRNVPQKLPS
GKRPDILKSEVIIPKMDSSVMQITIPACPNRSSTSPSRSRRVKTRHRKPGKGSSGDLAGL
KANQSSPNRDSTAQTNGSTTNTSKQLLEPSAALRETPPRSDTPSEDAASFPFSSSPDSPC
GRGAAARRASLGSPRLLLDGEDKEEGAGAVRMPRGASGGIGSQHLTPSAILYRAAITRKQ
RRGVSSEEEEGEVDSEVELPRRRRPTSITKCQSVSTFSSENLSVSDGEEGHTTDHSHSGT
PDVVSTNTDDRLDDRSDDLLSQGSEIPADNTDPAQASDGLSERDGALGRAKAQLDAGQNP
NESRALCDDSDCDSAELDQSGSGEPSRPPSAGAWAPPSQLYQGSTQTPHSGPL
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggacctgtatccatgagccccgtgccccttccccctccctctcaggcttcagc
actcccatctcagaaccgctctatcgaaggctcgatggagatacccctgcgtgtaccccc
gaaacggacctgacccccacacagtgtgtcctacgtaacgtgctatccattgacacgggc
gcacaggtggtgccggggggcagcagccccactcccagtgatggaccctcagcgcacttt
gacaacagcgtgctaaaactacatgaacatgaggcctgccagtgtggcggtggagccgaa
gctgggcacagcccagaggctggcgctgttcggagccagtcagagaacattcggctacaa
tcaggaagcggaggttttttggagggactgtttggctgcctaaaaccggtttggaccatg
atcggaaaggcctactccactgaacacaaacacagtaacgaagagtcctgggaggttcct
tttgaggaaatctctgacttgcagtgggtgggcagcggggcacagggcgccgtcttcctt
ggcaagttccacggagaggaggtggccgtgaagaaagtgcgggacatcaaggagactgag
atcaaacacctacgcaaactcaagcaccccaacatcatcactttcaagggcgtgtgcaca
caggctccctgttactgtatcctaatggaatactgtgctcaaggccagttgtatgaggtg
ctgagggcgggtcgtaaaatcaccccgtccctcctggttgactggtctatgggcattgca
ggtggcatgaactacctccaccttcacaaaatcatccatcgcgacctcaagtcacctaat
atgctgattacccacgatgacctggtaaagatctctgactttggaacctcaaaggagctc
agcgacaagagtaccaagatgtcgtttgctgggactgtggcttggatggcccctgaggtc
attcgtaacgagcctgtctccgaaaaggtggacatctggtcctttggagtggtgctgtgg
gagatgttgacaggagagatcccttataaagatgtggactcctccgccatcatctggggt
gtggggaacaacagcctccagctgccgataccggagagctgccctgacggcttcaagatc
ctcctcagacagtgctggaattgtaagcctagaaataggccctctttccgtcagatcctc
ctccatttggacattgcgtctgctgatgtgctgtccaccccacaagagacgtacttcaag
tctcaggctgaatggcgagaagaggtgaaacggcactttgagaagatcaagtcggagggt
acttgtctccaccggcttgatgaagaactaatcaacagacgcagagaggagctcaggcat
gctttggatattcgtgagcactatgagaggaaactggagagagctaacaatctctacatg
gagctgagcgccgttatgctgcagctggagctgaaagagaaagagctgcagaggagagag
cagtccctggataaaaagtacccaggtctgttcaagcaccacagttccagacagagcagc
tcctcaaacactatggacaagctcatcaagaagagaaatgttccacagaagcttccttca
ggaaagaggccagacatcctcaaatctgaggtaatcattcccaaaatggattcttccgtg
atgcaaatcactattccagcgtgccccaacagaagctccacttctcccagccggtcccga
agggtaaagactcgccaccgcaagccgggtaaaggcagcagtggggacctggctggactt
aaggcaaatcagtcctctcctaacagggactcgactgcccagacgaatggctccacaacc
aatacctccaagcagctgctggagccctctgctgccctgcgggaaactcccccgcgcagc
gacacgccgagcgaggacgccgcgtcgttcccgttctccagcagcccggattccccgtgt
gggagaggggcagcagccagaagagcatctctgggatctccgcgcctactactcgacggc
gaggacaaagaggaaggagctggggccgtgaggatgccacggggggcgtcggggggcatc
gggagtcagcacctcactccgtcagccattctgtacagggcagctatcacacggaagcag
agacgcggagtgtcatcagaagaggaggagggtgaagttgacagtgaggttgagttgcca
cggagacgacgtccgaccagtatcaccaagtgccagtcggtctcgacctttagctcagag
aacctgtccgtttccgatggcgaggagggtcacaccactgaccactcccacagcggcacc
cctgacgtggtcagcactaacacggatgacagactggacgaccgcagcgacgacctcctg
tctcagggttcggagatcccggccgacaacaccgatcccgcgcaagcgtccgacggcctg
tcggagagagacggagcgctgggccgggctaaagctcagctggatgctgggcagaatccc
aatgagagtcgcgccctgtgtgatgattcggactgcgacagcgctgagctggaccagtct
ggcagcggagaaccgagccgtcctcccagcgccggggcctgggctccgccatcgcagctg
tatcagggctccacacagacgccccactctgggcctctgtag

DBGET integrated database retrieval system