KEGG   Takifugu rubripes (torafugu): 101078683Help
Entry
101078683         CDS       T02386                                 

Gene name
usp7
Definition
(RefSeq) ubiquitin specific peptidase 7 (herpes virus-associated)
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101078683 (usp7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101078683 (usp7)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101078683 (usp7)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101078683 (usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1112 aa AA seqDB search
MNHHHHHTQQQQQKAGEQQLSEPEDMEMEAGDTDEPPRIPANPVINGNLAMGDGHHNTEE
DMEDDTSWRSEATFRFVVERFSRLSESVLSPSCFVRNLPWKIMVMPRFYPDRPHQKSVGF
FLQCNAESDSTSWSCHAQAMLKIINYKDDEKSFSRRISHLFFHKENDWGFSNFMSWSDVT
DPERGFIDDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQ
LRRAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQ
ELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGK
KNIFESFKDYVATEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQ
NIKINDRFEFPDQLPLDEFLQKPDSKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKV
SVKETIWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLLP
MTDVDIPQQLVERLQEEKRVEAQKRKERQEAHLYMQVQMVTEDQFCGHQGNDMYDEEKVK
YTVFKVLKSSTLQEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMID
LSDTENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPIS
CKIRDLLPVMCERAGFQQETSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQK
DDPENDSSELPTAKDYFRDLYHRVDVIFCDKTIHNDPGFVVTLSNRMNYFQVAKTVAQRL
NTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFEN
RRSFKSIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELSEKGSEKLRLLEIVSYKII
GVHQEDELLECLSPAASRTFRIEEIPLDQVDLDKDGEMLIPVAHFHKEVFGTFGTPFLLK
IRQGESFREVMRRIQNMLEIQEKEFEKFKFAIVMMGRHQYITEDEYEVNLKDFEPQPGNM
PHPRPWLGLDHFNKAPKRGRYTYLEKAIKIHN
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatcaccaccacacgcagcagcagcagcagaaagccggcgagcagcagcta
agcgaaccggaggacatggagatggaagccggcgacacagacgagcccccgagaatcccg
gcgaacccagtgatcaatggtaacttggccatgggcgacggacaccacaacacagaggaa
gacatggaggacgacaccagctggcggtccgaggcgaccttccgcttcgtggtggaacga
ttcagccgcctgagcgagtcggtgctcagcccgtcgtgcttcgtcagaaacctgccgtgg
aagatcatggtgatgccgcggttctaccctgaccggccgcaccagaagagcgtgggcttc
ttcctccagtgcaacgctgagtcggactccacatcgtggtcgtgtcacgcacaggcaatg
ttgaagatcatcaattacaaagacgatgagaaatccttcagtcgcaggatcagccacctt
ttcttccacaaagagaacgactggggcttctccaacttcatgtcatggagcgacgtgacg
gacccagagaggggcttcatcgacgacgacaaagtgacctttgaggtctacgtccaggca
gacgctccgcacggagtggcctgggactctaagaaacacacaggctacgttgggctgaag
aaccagggagctacgtgctacatgaacagcctgttacagacgctcttcttcaccaaccag
ctacggcgggcggtctacatgatgcccacagagggcgatgactccagcaagagcgtcccc
ctggcgctgcagagggttttctacgaactgcaacacagcgacaaacctgtcggtaccaag
aagctcaccaagtccttcggatgggaaacactagacagcttcatgcaacacgatgttcag
gagctgtgcagagtgcttctggacaatgtagagaacaaaatgaaaggcacttgcgtcgaa
ggaaccatccccaagctcttcagagggaagatggtgtcctacatccagtgtaagcacgtg
gactaccggtcagagcggatagaggactattacgacatccagctaagcataaaaggaaaa
aagaacatctttgagtcgttcaaagattacgtcgcaaccgagcagttagacggagacaac
aaatacgatgcaggagaacacggcctgcaggaagcggagaagggtgtgaagttcctcacg
ttccctccgatcctccacctgcagctcatgaggttcatgtacgacccacagactgaccaa
aacatcaagattaacgacaggtttgagtttccggatcagctgcccttggatgagttcctc
cagaagccagactcaaaggatccggccaactacatcttgcacgcagtgctggtccacagc
ggggacaaccacggcggtcactacgtcgtctatcttaatccaaaaggagacggcaaagtg
agtgtcaaggaaacaatatggtgtaaatttgacgacgatgtcgtgtcgcggtgcactaag
gaagaagccatagagcacaactatggtgggcacgacgacgacctgtcagtgcgccattgc
accaacgcatacatgctggtctacatccgggagtccaagctgagtgaggtgctcctgccg
atgactgacgtggacatcccccagcagctggtggagcgtctgcaggaggagaaaagggtg
gaggcccagaagaggaaagagcgccaagaggctcacctctacatgcaggttcagatggtg
accgaggatcagttctgtggtcatcagggcaatgacatgtacgacgaggagaaggtcaag
tacacggttttcaaggtcctgaaaagctcaacgctgcaggagtttgtccagaatctttcg
cagaccatgggttttccacaggatcagatgaggctgtggcccatgcaagcccggagcaac
ggaaccaagcggcccgccatgcttgactacgaggccgactgcaacaagtcgatgatcgac
ttgagcgacaccgagaatccctggacaatatttttggagactgtggatccagagctggca
gccagtggggccacattacccaagtttgataaagatcatgatgtcatgttgttcttgaaa
atgtatgatcccaaaacaagaagcttaaattattgtggacatatctacacacctatatcc
tgtaaaataagagaccttctgccagtcatgtgtgagagagcagggtttcagcaggagact
agccttatcctctatgaggaagtaaaacctaatctaaccgagcggatacaggactacgac
gtctctctggacaaggccctggatgagctcatggatggggacatcattgtcttccagaag
gatgacccagagaatgacagcagtgagctgccgacagctaaggactatttccgggatctc
taccaccgcgtggatgtcattttctgtgacaagaccatccataatgaccccgggttcgtg
gtgacgctgtccaaccgcatgaactactttcaggtggccaagacggtggcgcagaggttg
aacacagaccccatgctactgcagttcttcaagtcacaggggtacagggacggtccaggg
aatcctctcagacacaattatgagggaactctgagggacctgctgcagttcttcaaaccg
cggcagcccaagaaactgtattaccagcagttaaagatgaagataacagactttgagaac
aggaggagttttaaatccatatggctcaacagccagttcagagaagaggagatcaccctc
tatcctgacaagcatggctgtgtccgggaccttttggaagaatgtaaaaaggcagtggag
ctctctgaaaaaggctctgagaagctcaggctgttagagatagtaagctataaaatcata
ggggttcaccaggaggatgaactgctagaatgtttatctccagctgccagccgcaccttc
agaatagaggagattcctttggaccaggtggacttggacaaggacggtgaaatgttaatc
cccgtcgctcatttccacaaagaagtcttcggaacctttgggaccccctttttgctcaag
attagacagggcgagtcattccgggaggtgatgaggaggatccaaaacatgctggaaatt
caggagaaagaatttgagaagttcaagtttgccattgtgatgatgggacggcaccagtac
atcactgaggacgagtacgaggtcaacctgaaggactttgaaccacagccaggtaacatg
ccccacccccgcccgtggttagggttggatcatttcaacaaagctccaaagagaggtcgc
tacacctacctggagaaagcaatcaagattcacaactaa

DBGET integrated database retrieval system