KEGG   Takifugu rubripes (torafugu): 101078772Help
Entry
101078772         CDS       T02386                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tru01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:tru00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tru04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 304 aa AA seqDB search
MTDVLLGLLLVAPVLLVTGGPVSVKDHNGTTPLVIWHGMGDNCCNPLSMGAVKKMLEEDI
PGIHVLSLMVGKNMIEDTENGFFKDVNEQVSMVCSQLAQDPHLKGGYNAMGFSQGAQFLR
AVAQRCPSPPMKTLISVGGQHQGVYGLPRCPGESSTVCDLIRKALNNGAYTELIQKHLVQ
AQYWHDPLNDDLYKKHSLFLADINQERVVNETYKKNLQLLEKFVMVKFLQDSMVDPVDSE
WFGFLKSGQAKETETLQESVLYKEDRLGLAAMDAAGKLVFLATQGDHLQFTREWFSQNLL
PYLR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtccttctgggccttttgctggttgctccagtgctgctggtcactgggggc
ccagtttctgtgaaggaccacaacgggaccaccccactggtgatctggcatggaatgggg
gacaactgctgtaatcctctcagcatgggggcggtgaagaagatgctggaggaagacatc
cctgggatccacgtgctctcactaatggttggaaagaacatgattgaggacacagaaaat
ggatttttcaaggacgtgaatgagcaggtgtccatggtgtgcagccagctggctcaggac
ccccacttgaagggaggatacaatgctatgggcttctcccagggggcacaatttctgaga
gctgtggctcagcgatgtccctccccaccaatgaaaacactcatctcagttggtggtcag
caccaaggtgtttacgggctgcccaggtgtcccggagagagctcgacggtgtgtgattta
attcgtaaagctctgaacaatggagcctacacggagctcattcagaaacacctggtgcag
gcgcagtactggcacgaccccttaaacgatgacctgtacaagaagcacagtctgttcctg
gccgacatcaaccaggagagggtcgtaaatgagacgtataagaagaaccttcagttactg
gagaagttcgtcatggtgaaattcctgcaggattctatggtggatcccgttgacagcgag
tggtttggcttcctgaagtctggacaggccaaggagacggaaactctgcaggagagcgtc
ctctacaaagaggaccggctcggcctggccgccatggacgcagctggaaaactggtcttt
ctggccacgcagggagatcatctccagttcaccagggagtggttcagccagaacctgctg
ccgtatttgcgttag

DBGET integrated database retrieval system