KEGG   Takifugu rubripes (torafugu): 101079011Help
Entry
101079011         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 38-like
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101079011
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101079011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 1026 aa AA seqDB search
MDKILEGLVCSDHSVTVKRAIVKRVVEAAEDDATEEQCLSMFTLTTRLFLLGEDAFQKQT
GVQVLDAYARCHRTEFEHFFSKDFVLILLQQGFGHLDRKDPAIIDYIHCCLRLLISCPSV
LEIFSVIQVEVLRMVCERPEPTLCARLSTLLSDFFQCIPKDKSGVLFCQQLVRTISYFHC
FASQDRDLREYVGQVTKVSTLLQNIWKADPATMLSSLQEVFAIISSTDPSFDPSIALASL
VQHIPVQMITVLIKSLTTDQNVKDASMTKALCRMIDWLSWPLAQHVDTWVIALLKGLSAV
QKFTILIDVTLLKIELVFSRLRYPIVRQGALSVLSHMLLSFQHSPEAFHLVVPHVVPLVQ
SLRSDGLPSSKALLLQFTELIHCMMYHYSGFPDIYDTILEAIKDLPKPTEEKIKLVLNQS
AWTSQSNSFGSGFLRQSGKSETGKTGLINLGNTCFMNSIIQTLFMATDFRHHVLSLHLNG
SNSLMKKLQLLFAFLAHTQRAAYAPRNFLEASRPPWFNAGSQQDCSEYLRFLLDRLHEEE
KTIHVLESVKPKLASHVDSTRTDPAGQTPPEMGHESPETGPQEERKTLIETMFGGTLLTR
IRCLQCHCISEKEEPFTDLSLAFCPSATSRYSSQPERPSEEPKGLYQGSVNGGSEILDPG
SSASQVSSVHSVTVTNEPSLTVPDMVNYFLAPEILDEDNAYFCEKCSSLQRAEKTMQVVS
APEYLILTLLRFSYDAKFHVRRKILENVTIPPLMRLPVYSRSKPSESFCPASSSQHLDCP
ESSENLAKKLKPSQQDEKDERRKTGQGVREDRSVQPALYVLSSVVVHSGVSSESGHYYSY
GRNIDGADGSQHPARHSPLNEALQNGQAECNPSNCSALSIPPQQAGSSGQEAKDWLLFND
SRVTFSSFQLVQNITNRFPKDTAYVLMYRKQDLPEESTDGGTAQSMAKVSSEPPLQKELL
DAIIKDNKLYLQEQELSARTQALQAPSSSCSFRPNGSDDNNPPGSCGPSGGGGGGGGFNT
ISRLVF
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaattttggaaggcctggtatgctccgaccactctgttacagtgaaacgagcc
atagtgaagcgggtagtggaagcggcagaggatgacgcgactgaggagcagtgtctgtct
atgtttacattaaccacccgcctcttcttgcttggcgaagatgccttccagaagcagact
ggtgtccaggttttagatgcctatgcacgctgccaccgtacagagtttgaacatttcttt
agtaaagactttgtccttattcttctccagcaaggttttggtcatttggaccgtaaagac
ccagcaatcattgactatattcactgctgcctgcggctgctgatcagctgcccctcagtg
ctggagatttttagtgtgattcaggtggaggttttaaggatggtgtgtgagcgtccagag
ccaacgctctgtgcccgcctcagcactttgctgtctgactttttccagtgcatccccaag
gataagtctggtgttttattctgtcagcagttggtcagaactatcagctattttcattgc
tttgccagtcaagatcgggacttgagggagtacgtagggcaggtgacaaaggttagcaca
ctgctccaaaacatatggaaggctgatccagcaacgatgctttcatctctgcaggaagtc
tttgctatcatctcttccacagacccctcctttgatccatccattgctctggccagcctc
gtccagcacattcctgtgcagatgatcacagttctcatcaagagcctcaccacagaccaa
aatgtgaaggatgcaagcatgacaaaggccctctgcaggatgattgactggctttcatgg
cctctggcacaacatgttgacacctgggtcattgctttactcaaaggactgtctgccgtt
cagaagttcaccatcctcatagacgttactctgcttaaaattgaactggtattcagtcga
ctgcggtaccccattgtgcggcagggggcgctgtctgttctctcccacatgctgctgagt
ttccagcactctcctgaggcgtttcatttggtggttccacacgtggttcctctggtccag
tcgttgaggtccgatggtctacccagcagtaaagctctcctgctgcagtttactgagctt
atacactgcatgatgtaccattactccggcttccccgacatctacgacaccatccttgag
gccattaaggatcttccaaaaccaacagaagagaagatcaagttggtactgaatcaaagt
gcctggacctcccagtccaactcatttggctcgggttttttgaggcaaagtgggaagtct
gagacgggaaagaccggtctgatcaacctgggcaacacttgcttcatgaattccataatc
cagacgctgttcatggccacagatttcaggcatcacgttttgtccctgcatctaaatggt
tccaactctctaatgaaaaagctgcagctgctctttgcttttctggctcacacacagagg
gcagcgtacgctcccagaaacttcttggaagcgtctcgacctccctggttcaatgctggc
tctcaacaggactgttccgagtacctcagatttcttctggacaggttacatgaagaggag
aaaaccatccacgttcttgaatcggtgaagccaaagctcgcctcccacgttgactcaacg
aggacagacccagcaggtcagactccaccagagatgggacacgagtcaccagaaacagga
cctcaagaggagcgaaagactttgatagaaacgatgtttggcgggactctgcttacccgt
attcgctgtctgcagtgtcactgcatctctgagaaagaagaacctttcacggacctgtcc
ttggccttctgtccatctgccacatctcggtacagttctcaacccgagcggccctcggag
gagcccaagggtctttatcagggttctgtcaatgggggtagcgaaatcctggatcccggc
tcgtctgcgtcccaggtgagcagcgtccactctgtaactgtgacaaatgagccttccctg
actgtgccggacatggtgaactactttctggccccggagatcctggacgaagacaatgcc
tacttctgcgagaagtgcagctccctccagcgtgccgaaaaaacaatgcaagtggtgtcg
gcacctgaatacctaatcctcaccctgctgcggttctcctacgatgccaaattccacgtt
cggaggaagattctggaaaacgtcaccattccgccgctgatgagacttcctgtatactcc
cgttcaaagccttcagaatctttctgtcctgcgtcttcatctcagcacctagattgtccg
gagagcagcgaaaatctggctaagaagctcaaaccgtcgcaacaagacgagaaggacgaa
aggaggaagacaggccagggggttcgagaagaccggtcagtccagccggcgctgtatgtc
ctcagttcagtggtggtgcattcaggcgtgtcgtcagagagcggacactactactcatac
ggacgcaacatcgatggggcggacgggtctcagcatccagcccgtcactctccgctcaac
gaagcgttgcagaacggtcaggccgagtgcaaccccagcaactgctccgctctctccatt
cccccccaacaagctggcagcagcggccaagaggcaaaggactggttgctgtttaacgac
agcagagtgactttctcatccttccagctggtgcagaacatcaccaatcgcttccccaag
gacacggcgtatgtgctcatgtacagaaaacaggacctgccggaggagagcaccgatggg
gggacagcgcagagtatggcaaaagtcagttcagaaccacccctgcagaaagagctgctg
gatgctattatcaaagacaacaagctgtatttacaggagcaggagctcagtgcccggaca
caggcccttcaggccccctcatcctcctgctcattcaggcccaacggttcagatgacaat
aacccaccagggagctgtggcccatctggtgggggaggaggaggagggggcttcaatacc
ataagtagactggtattctaa

DBGET integrated database retrieval system