KEGG   Takifugu rubripes (torafugu): 101079168Help
Entry
101079168         CDS       T02386                                 

Definition
retinoic acid receptor RXR-gamma-B-like
Orthology
K08526  
retinoid X receptor gamma
Organism
tru  Takifugu rubripes (torafugu)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:tru04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:tru03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 462 aa AA seqDB search
MWHTLASPATGGSPGQEIDSGHYSSGPMSAAHAQPAHMGGMVGHPSVINTSRPLLSPMTT
LGSPMNGLASPYSVITSSLGSPSVSLPSTPNMNFGPINSPQMNSMNSSEDIKPPPGLHNL
GNINYQSTSPGGISKHICSICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKEC
LIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGRERGDSEVESTSGFNEDMPVDKILD
AELAVEPKTETYNEGIPSNSTNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSVTVKDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDM
QMDKTELGCLRAIVLFNPDAKGLSNPQEVEGLREKVYASLESYTKHKYPDQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQIT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtggcacacgctggcatcacctgcaactggaggaagccctgggcaggagatagactct
ggccactattcgtcggggccgatgagcgctgcccacgctcagccggctcacatgggtggc
atggtgggccacccgtcagtcatcaacacctccagaccgctgctgtcccccatgaccacc
ttgggctcaccaatgaacggcctggcctcgccctactctgtcatcacttcttctctgggc
tcgccatctgtgtcgctgccgtctacacccaacatgaactttggacccatcaatagtcca
cagatgaattctatgaacagctcagaggacatcaagcctccgccgggtctgcacaacctg
ggaaacatcaactaccagtcaacgagccccggcggcatttcaaaacacatctgctccatt
tgcggggaccgctcctcaggaaagcactatggcgtctacagctgtgagggatgcaaaggc
ttctttaagaggaccgtccgtaaagatctcacctacacatgtcgagacaacaaggagtgc
ctgattgacaagcgccagaggaaccgctgccaatactgccgctaccagaagtgcctcgcc
atggggatgaagcgggaagccgtgcaggaagagaggcagcgggggagagagcgcggagac
agcgaggtggaatctaccagcggcttcaacgaggacatgcctgtggacaagatcctcgat
gctgaattggccgtggagcccaaaacagagacgtacaatgaaggaatccccagcaactca
acaaacgaccccgtcaccaatatctgccaggcagcagacaagcagctcttcaccttagtg
gagtgggccaagaggatcccgcacttttctgaactccccctcgatgaccaggtcattctg
cttcgagcaggctggaatgagctcctcatcgcctccttctcgcatcgctctgtcacagta
aaagacggcatcctgctggcgacgggtctccacgttcatcgcagtagcgctcacagcgct
ggagtgggctccatttttgatcgggtcctgacggagctggtgtccaagatgaaagacatg
cagatggacaagacagagctcggctgtctgcgcgccatcgtcctcttcaacccagatgcg
aaaggtctttcaaacccccaagaggtcgaggggctgagggaaaaggtttacgcgtcgctg
gagtcgtacacgaaacacaaataccccgaccagccgggcaggtttgccaagttgctgctg
cgcctgcccgctctgcgctccatcggcctcaagtgtctggagcatctgttcttcttcaag
ctcatcggcgacacgcccatcgacaccttcctgatggagatgctggaggcgccgcatcag
atcacatga

DBGET integrated database retrieval system