KEGG   Takifugu rubripes (torafugu): 101079284Help
Entry
101079284         CDS       T02386                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101079284
   00051 Fructose and mannose metabolism
    101079284
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     101079284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 439 aa AA seqDB search
MAEQEEFFPSVPKIPYLPNADPGDVMCFKHYHAEEVLMGRKMEDWLRFSVCYWHSFCGTG
ADPFGFPTLCRSWNEGAPMEAAKRRLRAAFEFFTKLGVKYYTFHDRDVAPEGSTLEESNR
NLDEITDLALQLQKQTGVKVLWVTCNLFAHRRYMNGAATNPDCHVLAYAGAQVKKGLDVA
KKLGAENFVFWGGREGFHSVHNTDVAAELKHMASFFKMAVKYKEKIGLKCQFLIEPKPKE
PCKHQYDYDAMSVIGFLKHYGLERDFKLNIEPNHTTLAGHSYEHDIVMASAFGMLGSVDA
NTGSPDLGWDTDQFPMDIRNTTLVMKTVVEQGGLQPGGLNFDAKVRRESTDVEDLFVAHV
AAMDTFARGLRNAVRIIEDGIMAGMVKDRYSSFSRDIGQKVDEGSATLEEMEAFIKEKGE
PKMMSGKQETYESIFNRYI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacaggaggaattcttcccgagcgtcccaaagatcccgtatttacccaacgca
gatccaggagatgtgatgtgcttcaaacactaccatgcagaagaggttctgatggggagg
aaaatggaggactggctcaggttctcagtctgctactggcactccttctgtggaactggt
gccgatcctttcgggtttccgacgctctgccgatcctggaatgaaggagcccccatggaa
gcagccaagaggcggctgagagccgcttttgagttctttaccaaactgggagtgaaatat
tacaccttccacgacagagatgtggctcctgaaggctccaccttggaggagtccaacagg
aacctggatgaaattacagatctggctctccagctgcagaaacagactggagttaaggtt
ctgtgggtcacctgcaacctgttcgcccaccgaaggtacatgaatggtgcggccaccaac
cccgactgtcatgtcttggcctacgctggcgctcaggttaagaaggggctggacgttgcc
aaaaagctgggcgcggagaactttgtgttctggggaggaagagaaggtttccactctgtc
cacaacaccgacgtcgccgccgagctgaaacacatggccagcttcttcaaaatggccgtc
aagtataaagagaagattgggctgaagtgtcagtttcttattgaaccgaagccgaaggag
ccctgcaagcaccagtacgactacgacgccatgagcgtgattggattcctcaagcattac
ggtctggagcgggacttcaagttaaacatcgagcccaaccacaccaccctggcaggacac
tcctacgaacacgacatcgtcatggcctccgcatttggcatgttgggttcggttgatgca
aacaccggctcccctgacctggggtgggacacggaccagttccccatggacatcaggaac
accacattggtcatgaagaccgtcgtcgaacaaggcggcctgcagccaggggggttgaac
tttgatgctaaggtgcgcagggagtcaacagacgtggaggacctgtttgtggctcatgtc
gcagccatggacacctttgccaggggtctgcggaacgctgtccgcattattgaggacgga
atcatggctggtatggtcaaggatcgatactccagcttcagtcgtgacattggacagaaa
gtggatgaggggtctgccaccttagaagaaatggaggccttcatcaaagagaagggtgaa
cccaaaatgatgtcagggaagcaagaaacgtatgaatccatcttcaaccgttacatttga

DBGET integrated database retrieval system