KEGG   Takifugu rubripes (torafugu): 101079297Help
Entry
101079297         CDS       T02386                                 

Gene name
kmt2a
Definition
(RefSeq) lysine (K)-specific methyltransferase 2A
  KO
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101079297 (kmt2a)
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101079297 (kmt2a)
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101079297 (kmt2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 4499 aa AA seqDB search
MAHSCRWRFPARPGGSSNSGTGRRAGRIRVTASLRSVPGAHPNAAGLGPGFDAALQVSSV
IESNLQKFRDVLGESSDSSSAEEEAFGGFRTVAEQKRIQSPSTTCSETPSPQEKKPRGRP
PRVLTAHKSAPSLPSHTSLPSSTQSKPEGPERPAEKIKRLPGRPPGTGEKRRGRPPSSSS
KKSWSTTVADDSRQDGSEDGVDTDEDRKSAKRAPFGPSQPNDNEAQLPKGGRGDAKVSNL
KRLRATKLSPLKSRLKTLPGVPRRRRGRPPSAERLKAEAAAAAGAAHLSAAIESGEGKHK
AFKARMGEQLSMPRSVDDIEDQDSCNSAASPASSKPGRTMGLRKSPRHRKPVRIVPSSKR
TDATIAKQLLQRAKKGAQKRLEKEAVASGSRGTGAIEAGIRKTQLKNIRQFIMPVVSTVS
LRIIKTPKRFIEDEGSFGTPTPHLKMARLETATSAVSASSQPTASSSPAPAQVSSALNVT
AGNSGAPTDNLPPPPPPAPSPSVQSTTPSLLNTNANNATNGRFSSSAASCGSSAVSQHSS
QLSSAESSRSSSPSLDDSSCDSQASEATQALSETEDHSPSLQGERKGNLLHSAKLPSPPS
EPEPEHVLQERNRRGRRGQGVSRESPNQRPRETLAPVAKKPIISPPTGVLMSSTFVNSQQ
ASSTASSSSSPPPPPLLTPPQLPQSASSSTAAIAEHHPQSTWMSHPVPPFMPGSSVLSGL
SDKRNRSILRQPTFRWTSLSHPEHQYFSSAKYAKEGLIRKPIFDNFRPPPLTAEDVGLSR
QGVSGAGGTPTVPFPAPSSAAGTGNRLFAPLHSHTHHQHPSSSRFDAPVQKRSPLLRPPR
FTPSEAHSRIFESVTLHSSSGSSPGSLSPHQTSPNSNRISRRRRQLGSGTPRGHLRSPSH
SMTRRSSQIGGQLSVGKGSSDTSVLTGSVSTSNPSSLQGVSSIPLATSALNPAPFSTFSN
VSLSLASQGTTDSRRGTAGNPPPSSNTSSSSSPLFQNFPPSAQDTVRGAGKGAKDKSVSI
SQEPSPKEKERDSEKNREKEKENKREGRKDSEKKSKIPSPDGSPTAPSSLFTVDGRDTED
PILTLASKKAPGRKKSTSVDLVSDTAPSEVRGLHSIGPLSIAKGCLSKKGRPSDKGAEIE
DGEKEKEKQSAANQQTASLPGQPGRQQLPVSSLGSVLAQAEKQPVSNKRVVGLLKKANAQ
LCEINKSKLKPTDQTKVQGQESDSSETSVRGPRIKHVCRRAAVALGRNRAVFPDDMPTLS
ALPWEEREKILSSMGNDDKSSVAGSEEAEPQSPPIKPRETRQKAIQEAPPKKGRRSRRCG
QCSGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKIFQKQEKGKKDKK
KKLSEKKEGLNPVKIPASDSGQKSSPPLQKEDPHRKKSESPPLKSAEDKLKLQSASKQPS
PGLDSSPAPDEPSQAPSAVTAQSPSPPLTADKKGHKPQQSAPTSSSSSSSSSSSSSSSSS
SSSSSSSSSSSPSSSAQNSPSQATQSHAPSQQQQRPVNSQASSKKDASPKIPLSETKRKP
QQHSAQQQSSSALSDTTDLKQLKKTHSCSVPPSPKQRPKDKPLMAKPSGSSTLNWVNTPS
TGSQGRSRAPFDGVHRIRVDFKRDHDVEKVWEAGGLGLLTSVPVTPRVLCFLCASSGNVE
FVFCQVCCEPFHLFCLGESERPLQEQFENWCCRRCRFCQACGRQHQKTKQQLLECDKCRN
SYHPECLGPNHPTRPTKKKRVWVCNKCVRCKCCGATKPGKSWDAQWSHDFSMCHDCAKLF
AKRNICVLCNKCYEDDEADGKMVECGRCHHRVHAKCEKLTDDMYELLSKLPESVAYTCTK
CTERHPAEWRTALERQLQGCVHHVLTALLNSRTSSHLLRYKQMVKPPELNPETEESLPSC
QQLEGPDPPVLTEVSTTPPSEFPPDLESVKKKTDQGRYSSVLEFSDDIVRIIQTAMNGDG
GHPESRKANSMVKAFFIRQMERIFPWFKVKESRFWEKQNVSANGLLPNAVLPPSLDHNYA
QWQERQELSRAEHSHLMKKIIPAPQPKTPWEPDSPASPPPLPPPPLLPPPPLIPDQEDGP
DFPPPPGITDNRQCLLCQKYGDENTNEGGRLLYIGQNEWTHINCALWSSEVFEDDEGSLK
NVHTAVLRGKQLHCQKCQLPGATVSCCLTSCTSNYHFMCARHCHCVFLEDKKVYCPKHRD
LIKGEVVSEFEVTRRVLVDLEGISLRRKWLSGLEPENVHMMIGSMTIDCLGILTELSDCK
RKLFPIGYQCSRVYWSTLDARKRCVYTCRILVCHPTLLESDLKNVMSPEENRTIAHSPPP
MTDFPDPFESPRRSDSLSPNNTPKLRVYTRNRHPSYPPCHHSLGPSPIPSLGGNTQPQSQ
ENVTPGEFPANPSIQNINARRNSSAPLSPPLHQLNRQRGVTSLPQILSRPLTSPPPLIPS
PARDPEKSKHLSKEVAKSQTLRDDERGRPFSTDRNRQKSSRDQEFRDVDKGQVSSQDQAI
KDSEKNPSSRELQKESDKCEVSGREPEKRTSLGKDLDHKESERGKLVSRDQVRDSEKRRQ
MIRGSDKGRHGSRDPIHRESNKSKSFSREPSNKDMEKSRSLSKEAGLKESDKHKQYSKET
GKDSGQGKDRLSSRDTDKGRPSSRDFSQRSTERNKDSGSGKDRNTGTQFKQAGDEAKNPG
LVPASSGQYSPPVGTAALTGQQRVGGTKQTDKQGKHGGKDQDDSMSPTSMPRHRLNSYSS
QSTGNVMQGSFHKDSVIGKTGSLSSIQKSSARKSNDYLPGPVTAAAMKPLWPSWTPAEED
VVKQGSMHLASPAASLAKEKQPKVKTAGSREVSKDHEREKTLQNNSKIPLLNNNTKATGS
FTTNATNTSSNNGSNSRVAVLGNSIEAHGNAQGEKLENQGGDRSSSKNRENYHSSERKNS
SGADNMHQSSSAPEKEVKTDSESHHKATTNQLPLSSRDKRKFVSFPSVTTLKAEMKLDPN
GTGTVGGISSSSNVTPTSTISPASQGTCRSALATLYSPSVSSSDSSESDTQPPIDEDVHT
KHLHIKHRDHHSLLSHAAEDEGDGPEDDNDRAMDGKHHEDDSDGSGSAKRRYPRRSARAR
SNMFFGLTPFYGVRSYGEEDLPFYGSGDGAGAIVKRRTGIRKKSAEGQVDGADDISSTSS
SGDSGEDEDDEMKQSGKDPFYYSFTRTIINPGDGLPSIEGIDQCVGRGSQLQRFLKDEAQ
QQQRAQGKTEEDLLNALTLGKPQIGQLDGVDDGSESDASTSTTTTTTTSSSTPNKSTPKR
RGRDRHVEKPDPHDLSKDADNSGGAVSSNTREGRKNQKENCLPLGGAVKSQSQGQDPLET
QLSLSSDLLKSDSDNNNSDDCGNILPSDIMEFVLNTPSMSMQALSQQSEPSSSELLLDEG
YVDVNRRKNMLFDDFSQPLSNAESGSVVESNVNSSMSVEEPYLPLELPSDLSVLTTRSPT
VSTSQNHTAGSLIPDSSDRNMLALTPNSEVISGDKSGDKKRAAVLQSENQHDASTLGNKN
TQVTEGHMTPEHFIPSSAIGQVVEPSGNQDVNRSSGTPGLPSSPSLPQKYLQTSTVAAGS
PSPVSGPSQTQVTSPAVIKPGPDKLILVNQQFQPLYVLQTVPNGVTQKLSATGVMDNSSQ
AVLSSMTLATGLNTGLSTAQPIFPAGGKVLGTMAHPSQIHTFTGTTQTGFQTGIPSTTSG
LLIGLPHDQSQILVSEAGRPQDLRPSVAIVSSSPSLTSSPAALASAHGKKRPISRLQPRK
TKKLARTRSQPALAPSEVNPPNMTLINLSSPQITASIPGQPGGLVELSTISTSQRKVPNI
IKRPKSGVMYLDPTTLIQQRIPGPAQSGVLGHDSSSHAHLLPCTVSGLNPSQSVVNVVSV
PPSGAAGLLAPGSVSLSTPVLGSTEITGSISNLLFKASPHGLGLSDQPMVLQSAGGAPLM
SQLTSSVQTSLSSSICVLPSQQTISMTVNQQAEIEGNNLHLQHQSQPLNRAQTLDSGPNS
AVTLAPSSATPLSPTKGCVVGVFTQTSALSQSNRTAPISRSSEPRPAKTNTTVTVLGAEK
GKQKTKRSRQSANFTSGKKLKVSQEEEHHSHHAGRAQSNSSSKDLSSLEPMDTGKPAEKT
TNKGVLGKKKTSEGHVLPANILGNEKGCVAEGAGSLPVASPPDQENSSDLDLDSKPKKGI
IFEICSEDGFHIRCESIEEAWRSLTDKVQEARSNARLKELSFEGVNGLRMLGIVHEAVVF
LLEQLYGSRHCHNYRFRFHKPDEPDEPPINPHGSARAEINHRRCVFDIFSFLASKHRQPP
EYRPHEDDGDEGQLKTARRISMELPLAVRFKQLKVTSKESVGVYRSPIHGRGLFCKKTIE
AGEMVIEYSGNVIRSVLTDKREKYYDGKGIGCYMFRIDDYEVVDATVHGNAARFINHSCE
PNCYSRVITVDGKKHIVIFASRRIYRGEELTYDYKFPIEDASSKLPCNCNSKKCRKFLN
NT seq 13500 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcggttccctgctcggcccggagggagcagcaactccggc
accgggaggagagcgggccgaatcagggttactgcgtctctgcggagcgtcccgggagcc
cacccgaacgcagccgggctcggaccgggctttgatgctgcactacaagtctcctcggtt
atcgagagcaacctgcagaaatttcgggatgttttgggggaatcgagtgactcgagcagc
gcggaggaagaagcatttggtggctttcggacagttgctgagcaaaaaagaatacagagc
ccttcaaccacatgttcagagaccccatccccacaggagaagaaacctagaggccgtcct
ccccgagtccttactgcacataaatctgctccaagtttaccttcacacacctcccttccc
tcctccacacagtcaaaacctgagggccctgaaaggccagctgaaaagattaaaagactg
cctgggaggccacctggcactggggagaagaggagaggtcgacctccatcctcaagtagc
aagaaatcttggagtacaacagttgcggacgacagcaggcaggatggatcagaggatggc
gttgacactgatgaagacaggaagagtgccaagagggcaccattcggcccttctcagcca
aatgacaacgaggcacagcttcccaaaggtggacggggcgatgccaaagtcagtaacctg
aagaggctaagagcgactaagctctcccctctcaagtcacgcctcaagactttgcctggt
gtgccccggcgcagacgtgggcggccaccctcagctgagcgcttaaaagctgaggcagct
gctgctgctggtgctgcacatctgtctgctgccattgaaagtggggaaggaaaacacaag
gcctttaaggccagaatgggagaacaactgtccatgccaaggagtgttgatgatattgag
gaccaggactcttgcaattcagctgcctccccagcttcctccaaaccaggcaggacgatg
ggtctcagaaaaagcccccgtcatcgaaagcctgtcagaatcgtcccctcttctaaacgc
actgatgcaactattgctaaacagctgctccagcgtgccaagaaaggagcgcagaagcgt
ctggagaaagaggctgtagccagcgggagtagaggaacaggagccattgaagctggcatt
aggaagacccaactgaaaaacatcaggcagtttattatgcctgtggtcagcacagtctcc
ctccgcatcatcaaaacccccaaacgttttattgaagacgagggcagctttggaaccccg
acgcctcacctgaagatggctcggttagaaacagcgacgtcagctgtctccgcatcttcc
cagcccacggcctcatcctccccagctcctgcacaggtatcttccgcacttaacgttacc
gctggtaactccggtgctcccactgacaacctccctcctccacccccacccgctccttcc
ccaagcgtccagtcaacgactcccagtctgctaaacaccaatgccaataacgccaccaac
gggcgatttagcagcagtgcggcatcttgtggctcaagtgctgtatctcagcattcctcc
cagctctcttcggctgagtcttccaggtccagcagcccaagcttggacgactcatcgtgt
gactcccaggcttctgaggccacacaggccttgtcagagacagaggatcactctccatcc
ttgcagggagagaggaagggcaacttattacacagcgcaaagcttccctctcctccctct
gagccagagcccgagcacgttttgcaggaaaggaatcgacggggccgaagaggtcaaggt
gtcagtcgggaaagtccgaatcagaggccgcgtgagacgctagcccctgtggcgaaaaaa
cctatcatcagcccaccaacaggagtgctaatgtcctctacttttgtcaattctcagcaa
gcttcatctacagcctcgtcttcgtcttcacctccgcctcccccgcttctcacaccgcca
cagcttccccagtcagcttcctccagcacagctgctatcgcggaacaccatccccagtcc
acttggatgtctcatcccgttcccccttttatgcctggatcgtcagttctctccggtttg
tcggacaaacgaaaccgttcgattttgagacagcccacctttcgctggacttctctgtcc
caccctgagcaccagtatttttcctcagctaaatatgctaaggaggggctgattcgtaaa
cccatatttgacaactttcgtcctcctcctctcacagctgaagatgtggggctgtcacgc
caaggtgtgagcggggcagggggaactccaacagttcctttccctgcaccaagcagtgca
gcagggactggaaatcgcctctttgcccctctacactcacacacccaccaccagcacccc
tcttcatcacgctttgatgcaccagtccagaagcgaagcccattgctgcgcccgcctcgc
ttcactcccagtgaggctcactctcgaatttttgagtccgttaccctacattcatcctct
gggagcagtccaggctctctttccccacatcagacatcccccaattcaaacagaatttca
agacgcaggagacaactaggctcaggaacaccacgtggccatctccggtctccttcccac
tcaatgacaagacgcagcagccaaatagggggacagttgtctgtaggaaaggggtcttct
gacacatctgtactgacaggctctgtctccactagtaatcccagctctttgcagggggtt
tcttcaattccacttgccactagtgccttaaatcctgctccattcagcaccttctctaat
gtatccctcagtcttgcgtctcaagggacaacagatagcaggagagggacagctggaaac
ccaccaccttcatcaaatacttccagctcttcttcccctctttttcaaaattttcctccc
agtgcccaggacacagtacgaggagctggaaaaggagctaaagataaaagcgtatcaatt
tcccaggaaccttctccaaaggaaaaagaaagggattcggagaaaaatcgagaaaaggag
aaggaaaataagcgggaaggaagaaaggattctgagaaaaaaagcaagattccttctcct
gatggctctcccactgcaccttccagcttgtttactgtggacgggagggacacagaagat
ccaattttgactcttgcttcaaaaaaggctccagggagaaagaaatccacttcagttgac
ttagtttccgacactgctccctcagaggtgcgtgggcttcattccatcggtcccttgtct
atagccaaagggtgtctctctaagaaaggcagaccatctgataaaggagcagaaattgag
gatggggaaaaggaaaaagagaaacagagtgctgctaaccagcagacagcaagccttcca
gggcaaccaggccgacaacagctccctgtctcctcgcttggatcagtgttggcacaggca
gagaaacagccagtgtctaacaagcgagttgttggactactgaagaaggcaaatgctcag
ctctgcgagatcaataagagtaagctgaagcctacagaccagaccaaggttcagggccaa
gagagcgactcatcagagacctcagttcgtggtccgcgcatcaagcatgtgtgtcgtcgg
gcagctgtggctcttggccgcaatagggcagtattccctgatgatatgcctacactcagt
gccttgccctgggaggagagagagaagatcctttcttccatggggaatgatgacaagtcg
tccgtagcaggctcagaagaggcagagccccagtccccgcctataaagccaagggaaaca
cggcaaaaggccattcaggaagctcctcccaagaaagggcgcaggtcaagacggtgtggc
cagtgctctggctgtcaggtcccagaagattgtggtgtctgtacaaattgtcttgacaag
cctaaatttggaggaagaaacattaaaaagcaatgctgcaagatgaggaagtgtcagaat
ttgcagtggatgccctcaaagatctttcagaaacaggaaaaaggaaagaaggacaagaag
aaaaagctgtccgaaaagaaggagggtctcaatcctgtaaaaatccccgcttcagattcg
ggccagaaatccagtcctccactacagaaggaggaccctcatcgtaaaaagagcgaaagc
cctccactaaagtcagcagaggataagctaaaacttcagtcagcatcaaagcagccgtct
ccaggcctcgactcatctcctgcccctgacgaaccatcacaagcccccagcgcagtcaca
gctcaatccccatctccacccctaacagcagacaagaagggacacaaaccacaacagtct
gcaccaacatcctcttcttcctcctcatcctcatcgtcctcctcgtcatcctcttctagt
tcgtcgtcatcttcttcatcgtcgtcgtcctccccgtcatcttcagctcagaattcgccc
tctcaggctacacagtctcacgcaccttcccagcagcagcagaggcctgttaacagtcag
gcatcttcaaaaaaggatgcttcgcccaagattcctctgagtgagaccaagaggaaaccc
cagcagcactcagcgcaacagcagagctcatcagcactttcagacacaactgatttgaaa
cagttgaaaaaaacacattcttgttctgttcctccatctcccaaacagcgaccaaaagac
aagcccttgatggcaaaaccctccggcagcagtactttaaactgggtgaacactccctcg
actgggagccagggtaggtccagagctcccttcgacggagtgcatcgaattcgagtggat
ttcaagagggaccacgatgttgagaaggtgtgggaggctggcggcctaggtctactcacc
tctgtgcctgtcacacccagggtgctctgcttcttatgtgcaagcagcgggaatgttgag
tttgtcttctgccaggtatgctgtgaaccgttccatctcttttgcctgggggaatctgag
cgccctctccaggagcagtttgagaactggtgctgccggcggtgcagattctgccaggcc
tgtggacgtcagcaccagaaaactaaacagcagctgctagagtgcgataagtgccgtaac
agctatcacccggagtgcctgggtcccaaccaccctaccagacccaccaaaaagaagaga
gtctgggtctgcaacaaatgtgtgcggtgtaagtgttgtggtgccactaaaccagggaag
tcctgggatgcccagtggtcacatgacttctccatgtgtcatgactgtgccaaacttttt
gctaaacgaaacatctgtgttctctgtaataagtgctacgaagatgacgaggctgacggc
aagatggtggagtgtggccgctgccatcaccgggttcatgcaaagtgtgagaaactgact
gatgacatgtacgagctgttatccaagctgcctgaaagtgtcgcttatacgtgcaccaaa
tgtaccgaacgccatcctgcggaatggaggacggcactggagaggcagctccagggctgc
gttcatcacgtcctcactgcactgctcaactcccgcacatcttcccatctgttgcgttac
aaacagatggtgaaacctccagagctaaacccagagacagaggaaagtctcccatcctgc
caacaactggagggtccagatcctccagtcctgacagaagtctccacaacaccccccagt
gaattccccccagacttggaatctgttaagaaaaagacagatcagggccgttacagttca
gtgctggagttcagtgatgacattgtgagaatcattcagacggccatgaacggtgatggc
ggccatcctgagagcaggaaagccaacagtatggtgaaggctttctttattcggcaaatg
gagcgaatattcccatggttcaaagtgaaagaatccaggttctgggaaaagcaaaacgtc
tctgccaatgggctcctcccaaatgccgttctgcctccatctctggaccacaactacgcc
cagtggcaggaaagacaggagctttcacgtgcagagcactcccacctcatgaaaaagatc
atcccagctccccaacccaaaacaccttgggaaccagattctccagcctcccctcctcct
ctgcctccaccaccgctgctcccaccacctcctctcatacctgatcaagaggatggccca
gatttccctccaccaccaggcattactgataacaggcagtgtcttctgtgtcagaagtac
ggtgacgagaatactaacgaggggggccgactgttgtacattgggcaaaacgagtggacc
catataaactgcgccctgtggtcatccgaggtctttgaggacgatgaggggtcattgaaa
aatgttcacacggctgtcctcagggggaaacagctgcactgccagaagtgccagttgcca
ggggccacagtcagctgctgtctcacatcatgcaccagtaactatcacttcatgtgcgct
cgtcattgtcactgtgtcttcctggaagacaagaaagtctattgtccaaaacacagagac
ctcatcaagggggaggtggtgtctgaattcgaagttacccgcagggtccttgtagatctt
gagggcattagtctcagaaggaaatggctgtcaggcctggagcctgaaaatgttcacatg
atgataggctccatgactattgattgcctgggtatactgactgagctctcagactgcaaa
cgaaaactcttccctataggataccagtgttcacgggtctactggagcactttagacgct
cgaaagcgatgtgtgtatacctgcaggattctagtttgccaccctactctgctggagtct
gacctaaaaaatgtaatgtctcctgaagagaatcgcacaatagcacacagccctcctcct
atgacagactttccagatccatttgaatcccccagacgttctgattccctttcccctaac
aacaccccaaagctcagggtttacaccaggaaccgacaccccagctaccccccctgtcac
cactcactaggtcccagtcccattccctccctaggtggcaacacgcagccccaaagccaa
gagaatgtgacacctggggagttcccagcgaaccccagtattcagaacatcaacgcacgt
cgcaacagctcggcccctctctctcctcccctccaccagttaaacagacaaagaggtgtt
acttccctacctcagatcttgtcacgaccccttacctcaccccctcccctcattccgtct
cctgccagagacccagaaaagtctaaacacctcagcaaagaggttgcaaagagccaaacc
ctgagggatgatgaaagaggaaggcccttctctacagacagaaacagacagaagtcatct
cgagaccaagaatttagagatgtcgacaaaggacaagtgtcaagtcaagatcaagctatt
aaagattctgaaaagaatccttcatctagagaactacagaaagaatctgacaaatgtgaa
gtatcaggcagggagccagaaaaaagaacatcattaggtaaagatttagaccacaaagaa
tctgagagggggaagcttgtcagtagagatcaagttcgagactcagaaaagagaagacaa
atgatcagagggtctgataaagggagacatgggagcagagacccaattcatagagaatct
aataagagtaaatcattctctagagagcccagtaataaagatatggaaaaatctcggtca
ctcagtaaagaagcaggactaaaggagtctgacaagcataaacaatatagtaaagagaca
gggaaagattctggccagggaaaagatagattgtccagcagagacactgacaagggtaga
ccttcctctagagatttcagtcaaagaagcacagaaagaaacaaagactctggctcaggc
aaagaccgtaacactggcacccagtttaaacaggctggagatgaggcgaagaaccctggg
ctggtacctgcaagttcaggccagtactcccctcctgtgggcacagctgctctcacaggg
cagcagagggtcggaggcactaaacagacggacaagcaaggaaaacacggcggcaaagac
caagacgattccatgagtcccacttcgatgcctcgtcatcgactcaactcttacagcagc
cagtctactggaaatgtaatgcagggttcattccataaggactctgtcattgggaaaact
ggatctctgtcttccattcagaagtctagtgcacggaaatccaatgattacttacctggc
ccagtgactgcagcagctatgaagcctctgtggccctcatggacaccggcagaggaggat
gttgttaagcaaggctccatgcacttggcctcacctgcagcctcacttgccaaagaaaaa
caacccaaagtaaagacagcaggcagcagagaggtttccaaagaccatgaaagagagaag
accctccaaaataacagcaaaattccccttcttaacaataatacaaaagcaactggcagc
ttcaccacaaatgctacaaacaccagctctaacaacggtagcaatagtagagtcgcagtg
cttggaaacagcattgaggcccatggaaatgctcagggggagaagctggagaaccagggt
ggggataggtcatcctcaaagaacagagaaaattaccattcatctgagagaaagaatagc
tctggcgcggacaacatgcatcagagcagttcagctccagagaaggaagtaaagaccgat
tctgagtctcaccacaaagcaacaactaaccagctgcccctgtcctccagagacaaacgg
aaatttgttagttttccttctgtaactacactaaaggcagagatgaagcttgaccctaat
gggactggtactgttggtggtatatcctcctcctctaatgtgacacctacctctaccatc
tctcctgctagccagggcacctgtcgctctgccctcgccacactgtactctccatcagtc
agcagcagtgatagctctgagtccgacacccaacctcccatagatgaggacgtgcacacc
aagcacttgcatatcaaacaccgggaccaccacagtctcctgtctcacgccgctgaggac
gagggcgatggcccagaggatgacaatgacagagctatggatggtaagcaccacgaggat
gacagcgacgggtctggttcggccaagcggcgttaccctcgacgcagtgcacgcgcacgc
tccaacatgttttttggcctcactcctttttacggggtccgctcgtacggggaagaggac
cttcccttctacggaagtggtgacggagcaggtgctatcgtcaagaggaggactggtatc
cgcaagaaatccgctgaggggcaggtggatggggcagatgatatcagcagcacttcttca
tcaggcgacagtggagaggatgaagatgatgaaatgaaacagagtggtaaagaccccttc
tactacagtttcaccagaacaatcattaaccccggtgatggcttaccatctatcgaaggg
atagaccagtgtgtgggtagaggttcccagctacaacggtttctgaaagatgaggcccag
cagcaacagagggcacagggcaaaacggaagaagacctgctaaatgctttgactttgggc
aagccacagatcggccagctcgatggagttgatgatggttctgaaagtgacgccagcacc
agcactacaacaactacaactacgtcctcttccaccccaaataaaagcactcccaagaga
aggggtagagacaggcacgttgagaaacccgaccctcacgacttaagcaaagacgctgat
aacagtggtggagcagtaagcagcaacacgcgtgaaggcaggaagaaccagaaagagaac
tgccttcctttaggaggagcggtcaagtcccagagtcagggtcaggatccactggaaacc
caactatccctcagttccgatctgttgaagtcagactccgacaacaacaacagcgacgac
tgcggtaacattttaccatctgatatcatggaatttgtgctcaacaccccctccatgtca
atgcaggcactcagtcaacaatctgagccatcctcctcagagctgctccttgacgaggga
tatgtggatgtaaacagacgtaaaaacatgctctttgatgacttttcccagccgctgtcc
aacgcggagagtggaagtgtagtagagagcaatgtcaatagttccatgtcggtagaggag
ccttatcttccgttggagctgccttctgacctctcggtcctgaccacacgcagccctact
gtcagcacaagtcagaaccacactgctggaagcctcatccctgattcgtcagaccgcaac
atgctggctttgactccaaactctgaggtgatcagtggagacaaaagtggggacaagaaa
agagcagctgttctacagtcagagaatcaacatgatgcttcaactttagggaacaaaaac
acacaggtcacagaaggtcacatgacccctgaacactttattccaagttctgccattggc
caggtagttgaaccttcaggtaaccaggatgtcaacaggagttctggcactcctggtttg
ccaagttctccttccctgcctcagaaatacctccaaacatcaactgtagctgctggcagc
cctagtcctgtttccgggccatcccagactcaagttaccagtccagcggtcatcaaacct
ggtcctgacaaactaattttggtcaatcagcagttccagcctctgtacgtccttcaaaca
gttcctaatggtgtcacccaaaaactcagtgccacgggagttatggacaacagctctcaa
gcggtgctgagttctatgactcttgcgacaggactgaatactggtttatccacagcccag
ccaatctttcctgctgggggcaaagtcttgggcaccatggcacacccctcacagatccac
actttcaccgggaccacacaaacaggcttccagaccggaatccccagcaccacctctggg
cttctcattggattgccccacgaccagtcgcagattttggtctcagaggctggtcgacca
caagatttacgtcccagtgttgccattgtgtccagttctccttccctcacttcatctccc
gctgcacttgcctccgctcatggcaagaaaaggcccatctctcgccttcagccaagaaaa
accaaaaaattagctcgcactcggagccagcctgctctggcaccatctgaagtgaaccca
cctaacatgaccctcatcaacttgtcttcccctcagatcaccgctagtattccgggccaa
cctggtggattagtcgagttaagtacaatctccacttctcagcgcaaagttccaaatatt
atcaagagaccaaaatctggggttatgtatctagatcccactactctgattcagcagaga
attcctggtcctgcacagtccggtgtccttggtcacgattcctcatctcacgctcatctt
cttccatgcacagtgtcgggtctcaatcccagtcagtcagtggtgaatgttgtgtcagtg
ccgcctagtggtgctgccggtctgctagcaccaggatcagtctccctctccacacctgtc
ctaggctctactgagatcaccgggtccattagtaacctcctgtttaaagccagcccacat
ggcttgggcttgtctgatcagccaatggttcttcagtcggccggaggagcgccgctgatg
tcacaactcacgtcgtctgttcagacatcactaagtagcagcatctgcgtgctgccctcc
cagcagaccatcagtatgactgtgaaccagcaagcagaaatagaaggcaacaatcttcac
ttgcagcatcagtctcagcctcttaacagagcccagaccctggactctgggcccaacagc
gctgtcactttagctcccagctcagcgactcctctgagtcccaccaaaggatgcgttgtt
ggcgttttcacacaaacttcggcgctctcccagagcaaccgaaccgctcccatttccaga
tcatcggaaccgagaccagcaaaaaccaacacaacagtgacagttttaggagcagaaaaa
ggcaaacagaaaacaaagagaagcagacagagcgccaactttaccagtgggaaaaagctt
aaagtatctcaggaagaagagcatcacagtcaccatgcaggtcgagcgcaatcaaactca
agttccaaagaccttagctccctggagcccatggacactggcaaacccgctgagaagacc
accaacaagggtgttctcgggaaaaagaagacatctgaaggacacgtcctaccagcaaac
atactgggcaacgagaaggggtgtgtagctgagggagcagggtctctcccagtggcttca
ccacctgatcaggaaaacagcagcgaccttgacttggatagcaaaccaaagaagggcatc
atctttgaaatctgcagcgaggatggttttcatatccgctgtgagagtattgaagaggcc
tggagatcactaactgataaggtgcaggaagctcgctccaatgcaagactcaaggagctc
tcctttgaaggtgtcaacgggttgagaatgctgggaattgtccatgaggccgtggtcttc
ctgcttgagcagctctacggctccagacactgtcacaactaccgcttccgctttcacaaa
ccagacgagcctgatgaaccgcccatcaacccccacggatcggcccgagcagagattaac
cacaggaggtgtgtttttgacatattcagtttcttggcctccaaacaccgccagcctcca
gagtacaggcctcatgaagatgatggtgacgaagggcagctcaagactgccagacgcatc
tccatggaactgccactggctgtgcgatttaaacagctgaaggtcacctccaaagagtct
gttggagtctacagatctccaattcatggccgaggtctgttctgtaagaaaaccatcgag
gctggtgaaatggtcattgaatattctggaaacgtcattcgatccgtgctcactgacaag
cgggagaaatattatgatggaaagggaatcggctgttacatgtttcgcatcgacgactac
gaggtggtggacgcaacggtgcacggcaacgccgcgcgcttcatcaaccattcctgcgaa
cccaactgctattctcgcgtcatcaccgtggacggcaagaaacacatcgtgatcttcgca
tctcgacgcatctaccgaggcgaggaactcacctacgactacaagttccccatcgaggac
gccagcagcaagctgccctgcaactgcaattcaaagaagtgccgcaagttcctcaactaa

DBGET integrated database retrieval system