KEGG   Takifugu rubripes (torafugu): 101079400Help
Entry
101079400         CDS       T02386                                 

Definition
alpha-2B adrenergic receptor-like
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:tru04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 517 aa AA seqDB search
MASTLDSSCSLELSSWNISTSVGASVPCNQSVIKPAPYSPEATAAFATAITLMVVFTIVG
NIMVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFKSLWCEIYL
ALDVLFCTSSIVHLCAISLDRYLSISRVTYGRQRTPKRIKAAIVVVWLISAIISFPPLLS
LNKSEAEDQENQRGPQCQLNDERWYILYSTIGSFFAPCLIMILVYIKIYQIAKQRSRRPP
GEPRKDGASCATPNQPARHVQANGKDEDSTPPSSSKTSNARPPTLAITPSPTPGETQTSN
NPSSNNLLHPPSSSPAATPNAASLESSTPTSVPAPNAKEEGKKGKRRGKKKADNNNGDSS
STESDMEHSHGGGRGSCSIPGSPAGGGIHSPGSVKRFRDMIATSKGAQLVPGRKSKPESN
PGAARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLKAVCPDTCAIPDPLFTFFFW
IGYCNSSLNPVIYTVFNKDFRKAFKKILCGSTKGTFF
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgactctggacagcagctgctccttagagctgagcagctggaacatcagcaca
agcgtgggagcctctgttccctgcaaccagagtgtgataaaacctgccccttactcgccg
gaggccaccgcagccttcgccaccgccataaccctgatggtcgtcttcaccatcgtgggg
aacatcatggtcatcatcgccgtcctcaccagtcggtccctccgcggtccacagaacctc
tttttagtgtcgctggctgctgccgacattctagtggcgacactcatcatcccattttct
ctggctaacgaactgctcgggtactggtacttcaagtcgctgtggtgtgaaatctacctg
gccctggatgtcctcttctgcacctcttccattgtgcacctgtgtgccatctcgctcgac
cgctacctgtccatctccagggtcacttatgggcgtcagcgcaccccaaagcgcatcaaa
gctgccattgtggtggtgtggctcatctctgccatcatctccttccctcctctactctcc
ctgaacaaaagcgaggcagaagaccaggagaaccagaggggaccccagtgccagctgaac
gacgagaggtggtatatcctgtactccaccatcggctccttctttgccccatgcctcata
atgatcctagtctacatcaaaatctaccaaattgcaaagcagcgatctcgccgtccgccg
ggcgagcccaggaaagacggggccagctgcgctacgccgaatcagcccgcccgacacgta
caggccaatggaaaggacgaagacagcacacccccttcgtctagcaaaacctccaacgcc
agaccacctaccctcgccatcaccccttctccaactcctggagaaactcagacctccaac
aatccctcctccaataatctcctccatcctccgtcctcctcgccagccgcgacccctaac
gcagcctccctcgagagctcaacccctacttcggtgcccgctcccaacgctaaagaggag
gggaaaaaaggcaagcgtcgggggaagaaaaaagccgacaacaacaacggcgacagttcg
agcacagaaagcgacatggagcacagccacgggggcggcagaggaagctgcagcatcccg
gggtcacctgctggaggcgggatccactccccaggctcagtgaagcgctttcgagacatg
atcgccacgtcgaagggagctcagctggtgcccggacggaagtcaaagccggagagcaac
cccggcgcggccagacgcaaagcgatggtcaacagagagaagcgcttcacctttgttctg
gccgtggtgatcggcgtctttgtcgtctgctggttcccgttcttcttctcctattctctg
aaggccgtgtgcccagacacgtgcgccatccctgacccactctttacttttttcttctgg
atcgggtactgcaattcctccctcaacccagtcatttacaccgtctttaacaaagacttc
cgaaaggccttcaaaaagatcctgtgtggaagcaccaagggtactttcttttag

DBGET integrated database retrieval system