KEGG   Takifugu rubripes (torafugu): 101079413Help
Entry
101079413         CDS       T02386                                 

Definition
(RefSeq) laminin subunit gamma-1-like
  KO
K05635  
laminin, gamma 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101079413
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101079413
Cell adhesion molecules and their ligands [BR:tru04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      101079413
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      101079413
     Laminin-2 Extracellular matrix (ECM) components
      101079413
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      101079413
   VLA-3
      101079413
     Laminin-10 Extracellular matrix (ECM) components
      101079413
     Laminin-11 Extracellular matrix (ECM) components
      101079413
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      101079413
     Laminin-8 Extracellular matrix (ECM) components
      101079413
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      101079413
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      101079413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1296 aa AA seqDB search
MEAKEVTERSVHRCKCNGHASECVRNAEGRLVCNCKHNTEGDDCGVCKAFYNQRPWRRAT
AESANECLPCDCNGKSGECYFDGELYRATGHGGHCRNCADNTDGPNCERCLDNYHGALDG
SGCLPCGCSAVGSESLQCDNRGVCTCKPGVTGDKCDRCQPGFHSLTQAGCRPCACSPSGS
TQECDVTTGQCRCKDNVEGFNCDRCKLGYFNLDHQNPLGCTACFCFQHSSVCESAEGFSV
DTITSSFQRDKFLGNQMLSYGQNLSLSFRVDRRDTRLSAEDLVLEGAGMRVAVPLIAQGN
AYPNENMQTYVFRLHDSTDYPWRPTISPADFQKLLHNLTAIKIRGTYSERSAGYLDDVSL
VTARQGSGLPARWVEKCSCPQGYQGQHCERCTPGYRRSRPHLGAFSACEPCSCNGHSDTC
GPDTGACDCQDNTAGLSCERCKDGFYGDASRGTPADCQPCPCPAGATCAVILRSREVVCT
NCPAGTTGKRCELCDDGFFGDPLGQSGPGRTCRACKCSDNFDPNAVGNCDRETGECLKCI
HNTDGFFCDRCKDGFYGNALASSPADKCKPCSCSPLGTVGGQSTCLQVTGQCPCHPNVAG
RDCGACQPGFFNLQSGSGCARCNCDPIGSTNGQCDIITGQCECQPGVTGLRCERCERDFF
GFSSSGCKPCDCDPEGSMLGQCKEDGRCECRPGFVGTRCDMCEENFFYNRSAPGCQQCPS
CYSLVRDKVNQQRQKLHELQTLIDNLSSGQETISDKAFEDRLKEAEKAIMELLEEAQTSK
DVDRALLEHLNTINNTLTTQWNRLQNIRNTVDNTSDQAGRAQTRVQDAKSLIERAQRELD
KARDAVSKVDIKPPSSVGDPNNMTLLAEEARALADRHKMEAEQIEKIAKDANDTSTKAYH
LLLKTLDGESKTSQEIDELNRKYNEAKDVAKNLEKQASKVQAEAEEAGDRALKIFANLTS
LPPFSTDALEAEANKIKKEAADLDKLIDKTEKEYNVLRDDLKAKEQEVRKLLEKGKSEQQ
TADQLLARADAAKALAEEAAKKGQSTFREAESILEDLRDFDKRVNDNKTAAEEAMKKIPF
INATIMAANQKTRQAEAALGNAAADAREAKTKAEEAERIASNVQKASTKTKEEAEKAFQD
TSALDSEVDDMMDQLGSAEQELAKKAAEADRDMMMASMASDNAKEAEDNARKAKGAVKMV
LNTITALLDQLGNIDRVDLSKLNEIDESLKNAKGKMSDSDLDRKLAELNDMARTQEDMIN
DYDRQIREIHADIANLNDIKNTLPEGCFNTPSLERP
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgaaggaggtaacggagcgctctgtgcacaggtgcaagtgtaacggccacgcc
agcgagtgtgtgaggaacgcagaaggacggctggtgtgtaactgcaaacacaacacggag
ggcgacgactgcggcgtctgcaaagccttctacaaccagcggccgtggcgaagggccacg
gcagagagcgccaacgagtgtctgccctgcgactgtaacggcaagagcggcgagtgttac
tttgatggcgagctgtaccgggccaccggtcacgggggtcactgcaggaactgcgctgac
aacacagacggtcccaactgcgaacgctgccttgacaactaccacggcgccctcgatggg
agcggctgtctgccctgtggctgcagcgctgtgggctcggagtccctgcagtgtgacaac
agaggcgtgtgcacgtgtaagccaggagtgaccggagacaagtgtgaccgctgccagcca
ggcttccacagcctgactcaggccggctgcaggccctgcgcgtgctcgccctcaggcagc
actcaggagtgtgacgtcaccacgggacaatgtcgctgcaaagacaacgtggagggtttc
aactgtgacaggtgtaaactgggctacttcaacctggaccatcagaaccccctgggctgc
accgcctgcttctgcttccagcattcgtccgtgtgtgagagcgcggagggtttcagcgtg
gacaccatcacctcgtccttccagcgagacaagttcttggggaaccaaatgctgagctat
ggacagaatctgagtctaagtttccgggtggaccggcgagacacgcggctctcagctgag
gacctggtcctggagggggctggcatgagggtagcggtccccctcattgcccagggcaac
gcctaccccaatgagaacatgcagacatatgtgttcaggctccacgacagcaccgactac
ccctggagaccaaccatcagccccgctgacttccagaagcttctccataatctgactgcc
atcaagattcgcggcacctacagtgagagaagtgccggttaccttgacgacgtctccctg
gtgacggccaggcagggttcgggacttccagcccgctgggtggagaagtgcagctgtcct
caaggttaccagggtcagcactgcgagcggtgcactcctgggtaccggcgctcgcggcca
cacctgggcgccttcagcgcctgtgagccctgcagctgtaacggccacagcgacacctgt
ggacccgatacaggagcgtgcgactgtcaggacaacacagctggcctgagttgtgaacgc
tgcaaagacggtttctatggcgacgccagtcgcgggacgccggctgactgtcagccgtgt
ccctgcccagctggagcgacctgtgctgtgatcctgaggagcagagaggtggtgtgcacc
aactgtccggcaggaaccacgggtaaacgctgtgaactctgtgacgacggcttcttcgga
gaccctctgggtcagagcggaccgggccgaacttgtcgcgcttgcaagtgcagcgataat
tttgacccaaatgcggtcgggaactgtgaccgtgaaaccggagaatgtctgaagtgcatc
cacaacacagacggcttcttctgcgaccgctgcaaggacggtttctatggaaacgccctc
gccagcagcccggccgacaaatgcaaaccttgctcctgttccccactgggaacagtggga
ggccagtccacctgtctccaggtcaccggccagtgtccctgtcaccccaacgtcgcaggg
cgggactgcggcgcctgtcagcccggcttcttcaatctacagagcgggagtggctgtgca
cggtgtaactgtgaccccatcggctccaccaatggccagtgtgacatcatcacgggacag
tgcgagtgtcagcctggcgtcaccggcctccgctgtgaacgctgcgaacgcgacttcttc
ggattcagctcctctggatgcaaaccttgtgactgtgacccggaaggctccatgttgggc
cagtgtaaagaagatggccgctgcgagtgtcggcctggttttgttggcactcgctgcgac
atgtgtgaggagaacttcttctacaaccggtcggctccgggatgccaacagtgtccgtcc
tgctacagcctggtcagagacaaggtgaaccagcagaggcagaagcttcacgagctgcaa
accctcattgacaacctcagctcaggacaggaaacgatcagcgacaaggccttcgaggac
cgcctcaaagaggcagaaaaggccatcatggagctcctggaggaggctcagaccagcaaa
gatgtggaccgagctctgttggagcacctgaacaccatcaacaacaccctaaccacccag
tggaaccgcctacagaacatccgaaacactgtggacaacaccagcgatcaggccggccga
gcccagaccagagtccaggacgccaagagcctgatcgagcgagcccagagggagctggac
aaagccagggatgctgtcagcaaagtggacatcaagcccccgagcagcgtgggagacccc
aataacatgacgctgttggccgaggaagcgcgggcgctagcagacaggcacaagatggaa
gccgagcagattgagaaaattgccaaagatgccaatgacacatcgaccaaagcgtaccac
ctgctgctgaagactcttgatggagaatccaagaccagtcaggagattgacgagctcaac
aggaagtacaacgaggccaaagatgtggccaagaacctggagaaacaggccagcaaagtt
caggccgaggccgaggaagccggagacagagcgctgaagatctttgccaatctgaccagc
ctgcctcccttcagcacagacgctctggaggctgaagccaataagatcaagaaggaggca
gcggacctggacaagctgatcgataagaccgagaaggagtacaacgtcttaagagacgac
ctgaaagccaaagagcaggaagtccgcaaattattggaaaaaggcaaaagtgagcagcag
acggcagatcagcttttggctcgagctgatgctgccaaagctctggcagaggaggcggcc
aagaaaggccagtccaccttcagggaggcggagagcatcctggaggacctgcgagacttt
gacaaacgggtcaatgacaacaagacggctgctgaggaggccatgaagaagattcccttc
atcaacgccaccatcatggccgccaaccagaagaccaggcaggcggaggcggcgctcggc
aacgccgccgcagacgcccgagaggccaaaactaaggccgaggaggcggagcgtattgcc
agcaacgttcagaaggcttccaccaagaccaaggaggaggccgagaaggcgttccaggac
acgagcgcgttggacagtgaggtggatgacatgatggaccagctgggctctgctgaacag
gaactggcaaagaaggcggccgaggcggaccgcgatatgatgatggcctccatggcatct
gacaacgccaaggaggccgaggacaacgcccgcaaggctaaaggggccgtcaagatggtc
ctgaacaccatcaccgccctgctggatcagctgggaaacatcgacagagtggatctgagc
aaactcaacgagatcgacgagtccctgaagaacgccaaaggcaagatgtccgacagcgat
ctggacaggaagctggcggagctgaacgacatggcacggacacaggaagacatgatcaat
gactacgatcggcagattcgggagatccacgccgacatcgccaacctcaacgacatcaaa
aacactttacccgaaggctgcttcaacacgccgtctctcgagaggccttag

DBGET integrated database retrieval system