KEGG   Takifugu rubripes (torafugu): 101079429Help
Entry
101079429         CDS       T02386                                 

Definition
glutathione S-transferase omega-1-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tru00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:tru00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:tru00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 239 aa AA seqDB search
MSTEKCHANGSPAPGPVPEGHIRLYSMRFCPFAQRTRLVLNAKGIKYETINIHLKDKPDW
FLQKNPLGLVPTLETPAGEVIYESPITCEYLDEVYPEKKLLPSTPFGKAQQKMMLEHFSK
IVPYFYKIVMGKKNGDDVSGLETELKEKLTKLNEDFANKKTKYFGGDSVTMIDYMMWPWF
ERLEVFGLKSCLDNTPELAKWTERMREDPAVKATSYSLDTHKAFYKTYADGKPDYDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgaaaagtgtcacgctaacggtagtcctgctccaggtccagtccctgaaggc
cacatcagactgtacagcatgagattctgcccatttgctcaaaggacgagattggtgttg
aatgccaaagggatcaagtatgaaaccatcaacattcatcttaaagacaaacctgactgg
ttccttcagaagaatcctcttggtctcgttccaacactggaaacacctgctggagaggtg
atatatgaatccccgatcacctgtgaatacctggatgaagtttaccctgaaaagaaactg
cttccttccacaccttttggtaaagctcagcaaaaaatgatgctggagcatttttccaag
atagttccatatttctacaagatcgttatgggtaaaaagaatggagatgatgtgtcagga
ctggaaactgaactaaaagagaagctgaccaaattaaatgaggactttgctaacaagaag
accaagtactttggtggtgattccgtcacgatgattgactacatgatgtggccgtggttc
gagaggctggaagtctttggactgaagagctgccttgacaacacacctgagctggcaaag
tggactgaacgcatgcgtgaggacccagcggtcaaagctacctcgtacagtctggacacg
cacaaggccttctacaaaacatacgctgatggcaaacctgattacgactacggcctgtaa

DBGET integrated database retrieval system