KEGG   Takifugu rubripes (torafugu): 101079476Help
Entry
101079476         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22
AA seq 489 aa AA seqDB search
MPVFTVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDEWGN
IKLKNGMTLLMMGSAEALPEEPAVRPMFVEDMTEEQLASAMELPCGLANLGNTCYMNATV
QCLRSVPELKTALRRYSGALRSTGANAPSDYITAALRDLYETMDKTSSSLPPIILLQFVH
MAFPQFAEKGDQGQYLQQDANECWLQMMRVLQQKLEPLESATPMETDSEGSAASACTKKN
LIEQYFGVEFETTMKCTESEDEEPIKGKESQLQLSCFINQEVKYLATGLRLRLQEEITKM
SATLDRNALYIKSSKLSRLPGYLTVQMVRFFYKEKEAVNAKVLKDVKFPLMLDVYELCTS
ELQEKMLTIRSRFKEVEDKKLEKQQQKVMQRPDGAKEVKYEPFSFPDDMGSNNSGYYDLQ
AVLTHQGRSSSSGHYVGWVKRKEDEWFKFDDDKVSVVTAEDILRLSGGGDWHIAYVLLYG
PRRLEILEE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccggtttttacagtgaatgtgaaatggggcaaagagaagtttgatgcggtagaacta
aacactgaggagccacccatggtgttcaaggctcagctctttgccctgacaggagttcag
cccgacagacagaaggtcatggtgaagggaggtaccctgaaggatgatgagtggggcaac
attaaattaaaaaatggaatgactctgctgatgatgggctcggctgaggccctgcccgag
gagcctgctgtcaggccaatgtttgtggaagacatgactgaggagcagctggcctcagct
atggagctcccttgcgggctggcgaacctggggaacacctgttacatgaacgccacagta
cagtgcctgcggtccgtgccagagctcaagactgcactcaggaggtactcgggagccctg
cgatccacaggagcaaacgcgccatcagattatatcacggcagctcttcgtgacttgtac
gagaccatggacaagacctcctcgagcctcccgcctatcatcttactgcagttcgtccac
atggcctttccacagtttgctgagaagggcgaccagggccagtacctgcagcaggatgct
aatgagtgctggctgcagatgatgagagtgcttcagcagaagttggaaccacttgagtcg
gctactcccatggagacagactctgaaggcagcgctgcttctgcctgtacgaagaagaac
ctaatcgaacagtatttcggcgtagaatttgaaacgaccatgaagtgcacagagtctgag
gatgaagagccaatcaaaggcaaggaaagccagcttcagctcagctgcttcatcaaccag
gaagtcaaatatctggcaacaggcttgaggctgagactgcaggaggaaatcacaaaaatg
tctgccaccttggacagaaacgccctgtatataaaatcttcgaaactgagccgtctccca
ggttacctgactgttcagatggttcgatttttctataaagagaaagaagctgtcaatgca
aaagtcctcaaggacgtcaagttcccgctcatgttggacgtttatgagctgtgcaccagc
gagcttcaggagaaaatgctgaccatcaggtccaggtttaaggaagtcgaggacaagaag
ctggagaagcagcagcaaaaagtgatgcagaggccagacggagccaaggaggtgaaatac
gaacccttttccttcccggacgatatgggctccaacaacagcggctactacgacctccag
gccgtcctgacgcaccaaggccgctccagctcctcgggccattacgtgggatgggtcaag
aggaaagaagacgaatggttcaagttcgacgacgacaaagtgagcgtggtgaccgccgag
gacatcctgcgactgtcggggggcggagactggcacatagcctacgttctactgtatggc
ccccggcggctggaaatacttgaagagtag

DBGET integrated database retrieval system