KEGG   Takifugu rubripes (torafugu): 101079482Help
Entry
101079482         CDS       T02386                                 

Definition
histone deacetylase 2-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cell cycle
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101079482
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101079482
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101079482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 479 aa AA seqDB search
MAYTTASGTKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHK
ATAEEMTKYHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSA
AGSVKLNRQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIH
HGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDESYE
QIFKPVMAKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTIRGHAKCVEYMKSFNLPLLML
GGGGYTIRNVARCWTYETAVALDTDIPDELPYNDYFEYFGPDFKLHISPSNMTNQNTQEY
MDKIKQRLFENLRMLPHAPGVQMQATPEDAVPDDSVDEDTEDPDKRLSIRATDKRIACEE
EFSDSEDEGEGGRKNVANHKKGKRPRVDEDKKDGEDKKSEIKEEEKTMDSSAEKTDSKR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacgactgcgagtgggaccaagaagaaggtctgctattactatgacggtgac
ataggaaattattattacggacaaggacatcccatgaaaccacatcgcatccggatgacc
cacaacctgcttctcaactatggactctacaggaaaatggaaatctatagaccacacaaa
gccacagcagaggaaatgaccaaatatcacagcgacgactacatcaagttcctgcgatcc
ataagaccggacaacatgtctgagttcagcaagcagatgcagcgcttcaacgtcggagag
gactgtcctgtgtttgacggcctgtttgaattctgccaactttctgctggaggatctgct
gctggctcagtgaagttaaacagacagcagaccgacatcgccgtcaactgggctggagga
cttcaccatgcaaagaagtcggaggcttctggcttctgctacgtcaacgatattgtcctg
gccatcttggagctgctcaagtaccaccagagagtgctgtacatcgacatagacatccat
catggagacggtgtggaggaggccttctacaccactgacagggtcatgaccgtgtccttc
cataaatatggggagtatttccctggaactggagacctcagggatattggggcaggaaaa
ggcaaatattatgccgttaacttccccctgcgtgatggcatagacgacgagtcttatgag
cagatctttaaacccgtgatggcaaaggtgatggaaatgtaccagcccagtgctgtggtt
cttcagtgtggcgctgactcgctgtcaggagatcgtcttggctgctttaacctcaccatt
cgtggccatgcaaagtgtgtggagtacatgaagtccttcaacctcccactgctcatgctg
ggtggaggaggatacaccatccgcaatgtggctcgctgctggacctatgagacagccgtc
gccctggacactgacattccagatgagcttccatacaatgattattttgaatactttggg
cctgacttcaagctgcacatcagcccatcaaacatgaccaatcagaacactcaggagtac
atggacaagatcaagcagcgcctctttgagaacctgaggatgctgcctcacgctcctgga
gtgcagatgcaggccacccctgaagatgccgtccctgacgacagtgtggacgaagacaca
gaagatcctgacaagcgcttgtccatccgtgccacagataagaggatagcctgtgaggaa
gagttttctgactcggaggatgaaggtgagggggggaggaaaaatgttgccaatcataag
aagggaaaaaggcccagagttgatgaagacaaaaaggatggagaggacaagaaaagtgaa
attaaagaggaggagaaaacaatggacagcagtgctgagaagactgactccaaaaggtga

DBGET integrated database retrieval system