KEGG   Takifugu rubripes (torafugu): 101079536Help
Entry
101079536         CDS       T02386                                 

Gene name
gys2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101079536 (gys2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101079536 (gys2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101079536 (gys2)
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101079536 (gys2)
Glycosyltransferases [BR:tru01003]
 Polysaccharide
  Storage polysaccharide
   101079536 (gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
18
AA seq 708 aa AA seqDB search
MPLPRSVSMTSLSGLLPAWEEDPLPVEELLLFEVAWEVTNKVGGIYTVIQTKAKVTVDEW
GENYFMMGPYFEHNFKTQVEACEPPNQAIRKAMDALLHNGCQVYFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWQTCSIGLPYHDREANDALILGSLIAWFFKELTDQLGDKPNVIGH
FHEWQAGPGLILSRSRKIPLATVFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGDRQI
YHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHS
TNKVHIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFIESLSRLNYLLRVHRN
DVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKEKFGKKLYDALLKGEIPDMNS
ILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSADPILSNIRRISLFNSRNDRVKIIFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFRSAEESCNQLTQFMFTFCQQSRRQRIIQRNRTERLSDLLDW
RYLGTFYMHARHLALSRAFPDKFKMEQVAPLKTEGFRYPRPYSVPPSPSASLHSTPHHSD
VEDDDDDDDGEPYNEEEEAERDRLNIKAPFVLGAVPEGKKKQPGESGN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccgcgctccgtatccatgacatctctgagcgggctgctgccggcctgggag
gaggacccgctgcctgtggaggagctgttgctctttgaggtggcctgggaggtcaccaac
aaagtcggaggcatctacaccgtgattcagacaaaagccaaagtcactgtggacgaatgg
ggcgagaactacttcatgatgggaccctactttgaacacaacttcaagacccaggtggaa
gcctgtgagcccccaaaccaggccatcaggaaggccatggacgcgctgctccacaacggc
tgtcaggtatattttggccgatggctgatagagggcagcccgtatgtgatcctcttcgac
atcggttctgcagcctggaacctggaccgctggaagggcgacctgtggcagacctgcagc
attggcctgccctaccacgacagagaggccaatgacgcgctcatcctgggctctcttatc
gcctggttcttcaaagagttaacagaccagttgggagacaagcccaatgtgattggtcat
ttccatgagtggcaggcaggtccgggcctcattctatcccgttctcgcaagatccctctg
gcgactgtcttcaccactcacgccaccttactgggacgatacctctgtgctgggaatgct
gacttttacaacaatctggacaagtttgacattgacagggaggcaggagacaggcagatc
taccaccgttactgcctggagagggcggcggttcactgtgctcatgtcttcaccacagtg
tctcagatcactgctgtggaagccaaccacatgctacacaggaagccagatgtggtgact
cccaacggtctgaacataaagaagttctcagcaatgcacgagtttcagaacctgcactcc
accaacaaagtccacatccaggagtttgtcagaggacacttctatggtcacctggatttc
aacctggagaagactctcttcttcttcattgctggacgttatgagttttccaacaagggg
gctgatctgttcatcgaatccctgtccagactgaactacctgctgcgggtccacaggaat
gatgtgaccgtggtagtcttcttcattatgccggctaagaccaacaactttaacgtggag
tcactgaagggtcaagcagtacgcaaacaactttgggacacggcccacacggtgaaggag
aagtttggcaagaagctgtatgacgctctgctaaaaggggaaatccctgacatgaactcc
atcctggaccgagatgatttcaccatcatgaagagagccatatacgccactcagagacat
agtctccctccagtcaccactcacaacatgctggacgactcagcagatcccatcctgtcc
aacatccgacgtatcagcctcttcaactccagaaacgatagagtcaagatcatcttccat
ccggagtttctgtcctccacaagtcctctgctccccatggactatgaagactttgttcgt
ggttgtaacctgggagtgttcccctcctattacgagccgtggggatatacacctgctgag
tgcacggtgatgggaattcccagtgtcaccaccaacctttctggttttggctgcttcatg
gaggagcatgtctcagaccctgcagcctacgggatttacatcgtggaccgtcgcttccgc
tccgcagaggagtcgtgcaaccagctgactcagttcatgtttaccttctgccagcagtcc
cgccgccagcgcattattcagcgcaacaggaccgagaggctctctgacctgctggactgg
agatacctgggaacgttctacatgcacgctcgacatctggcactgagcagggcattccca
gacaagttcaagatggagcaagtggctcctctgaagacagagggcttccgctaccctcgg
ccctattcggtgcccccctccccttctgcctccctccactccaccccccaccatagtgat
gtggaggatgatgatgatgacgatgatggtgagccctacaacgaggaggaagaggctgaa
agagaccgactaaacattaaggctccctttgttctcggtgctgttccagagggcaagaag
aagcaaccaggagagtctggaaactaa

DBGET integrated database retrieval system