KEGG   Takifugu rubripes (torafugu): 101079536Help
Entry
101079536         CDS       T02386                                 

Definition
glycogen [starch] synthase, liver-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101079536
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101079536
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101079536
Glycosyltransferases [BR:tru01003]
 Polysaccharide
  Storage polysaccharide
   101079536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 708 aa AA seqDB search
MPLPRSVSMTSLSGLLPAWEEDPLPVEELLLFEVAWEVTNKVGGIYTVIQTKAKVTVDEW
GENYFMMGPYFEHNFKTQVEACEPPNQAIRKAMDALLHNGCQVYFGRWLIEGSPYVILFD
IGSAAWNLDRWKGDLWQTCSIGLPYHDREANDALILGSLIAWFFKELTDQLGDKPNVIGH
FHEWQAGPGLILSRSRKIPLATVFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGDRQI
YHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHS
TNKVHIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFIESLSRLNYLLRVHRN
DVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAHTVKEKFGKKLYDALLKGEIPDMNS
ILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSADPILSNIRRISLFNSRNDRVKIIFH
PEFLSSTSPLLPMDYEDFVRGCNLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFM
EEHVSDPAAYGIYIVDRRFRSAEESCNQLTQFMFTFCQQSRRQRIIQRNRTERLSDLLDW
RYLGTFYMHARHLALSRAFPDKFKMEQVAPLKTEGFRYPRPYSVPPSPSASLHSTPHHSD
VEDDDDDDDGEPYNEEEEAERDRLNIKAPFVLGAVPEGKKKQPGESGN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccgcgctccgtatccatgacatctctgagcgggctgctgccggcctgggag
gaggacccgctgcctgtggaggagctgttgctctttgaggtggcctgggaggtcaccaac
aaagtcggaggcatctacaccgtgattcagacaaaagccaaagtcactgtggacgaatgg
ggcgagaactacttcatgatgggaccctactttgaacacaacttcaagacccaggtggaa
gcctgtgagcccccaaaccaggccatcaggaaggccatggacgcgctgctccacaacggc
tgtcaggtatattttggccgatggctgatagagggcagcccgtatgtgatcctcttcgac
atcggttctgcagcctggaacctggaccgctggaagggcgacctgtggcagacctgcagc
attggcctgccctaccacgacagagaggccaatgacgcgctcatcctgggctctcttatc
gcctggttcttcaaagagttaacagaccagttgggagacaagcccaatgtgattggtcat
ttccatgagtggcaggcaggtccgggcctcattctatcccgttctcgcaagatccctctg
gcgactgtcttcaccactcacgccaccttactgggacgatacctctgtgctgggaatgct
gacttttacaacaatctggacaagtttgacattgacagggaggcaggagacaggcagatc
taccaccgttactgcctggagagggcggcggttcactgtgctcatgtcttcaccacagtg
tctcagatcactgctgtggaagccaaccacatgctacacaggaagccagatgtggtgact
cccaacggtctgaacataaagaagttctcagcaatgcacgagtttcagaacctgcactcc
accaacaaagtccacatccaggagtttgtcagaggacacttctatggtcacctggatttc
aacctggagaagactctcttcttcttcattgctggacgttatgagttttccaacaagggg
gctgatctgttcatcgaatccctgtccagactgaactacctgctgcgggtccacaggaat
gatgtgaccgtggtagtcttcttcattatgccggctaagaccaacaactttaacgtggag
tcactgaagggtcaagcagtacgcaaacaactttgggacacggcccacacggtgaaggag
aagtttggcaagaagctgtatgacgctctgctaaaaggggaaatccctgacatgaactcc
atcctggaccgagatgatttcaccatcatgaagagagccatatacgccactcagagacat
agtctccctccagtcaccactcacaacatgctggacgactcagcagatcccatcctgtcc
aacatccgacgtatcagcctcttcaactccagaaacgatagagtcaagatcatcttccat
ccggagtttctgtcctccacaagtcctctgctccccatggactatgaagactttgttcgt
ggttgtaacctgggagtgttcccctcctattacgagccgtggggatatacacctgctgag
tgcacggtgatgggaattcccagtgtcaccaccaacctttctggttttggctgcttcatg
gaggagcatgtctcagaccctgcagcctacgggatttacatcgtggaccgtcgcttccgc
tccgcagaggagtcgtgcaaccagctgactcagttcatgtttaccttctgccagcagtcc
cgccgccagcgcattattcagcgcaacaggaccgagaggctctctgacctgctggactgg
agatacctgggaacgttctacatgcacgctcgacatctggcactgagcagggcattccca
gacaagttcaagatggagcaagtggctcctctgaagacagagggcttccgctaccctcgg
ccctattcggtgcccccctccccttctgcctccctccactccaccccccaccatagtgat
gtggaggatgatgatgatgacgatgatggtgagccctacaacgaggaggaagaggctgaa
agagaccgactaaacattaaggctccctttgttctcggtgctgttccagagggcaagaag
aagcaaccaggagagtctggaaactaa

DBGET integrated database retrieval system